PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G06070.1
Common NameAtbZIP69, T21E18.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 423aa    MW: 47130.9 Da    PI: 6.3614
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G06070.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_132.22.2e-10212268561
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                  kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l  l+     l  
  AT1G06070.1 212 KRAKRIWANRQSAARSKERKMRYIAELERKVQTLQTEATSLSAQLTLLQRDTNGLGV 268
                  9*******************************************9999887766655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003382.6E-15208272IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576210273IPR004827Basic-leucine zipper domain
SuperFamilySSF579598.13E-11212263No hitNo description
Gene3DG3DSA:1.20.5.1709.1E-11212264No hitNo description
PfamPF001709.1E-9212262IPR004827Basic-leucine zipper domain
CDDcd147034.81E-24213262No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000005anatomycultured plant cell
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 423 aa     Download sequence    Send to blast
MDKEKSPAPP PSGGLPPPSG RYSAFSPNGS SFAMKAESSF PPLTPSGSNS SDANRFSHDI  60
SRMPDNPPKN LGHRRAHSEI LTLPDDLSFD SDLGVVGAAD GPSFSDDTDE DLLYMYLDME  120
KFNSSATSTS QMGEPSEPTW RNELASTSNL QSTPGSSSER PRIRHQHSQS MDGSTTIKPE  180
MLMSGNEDVS GVDSKKAISA AKLSELALID PKRAKRIWAN RQSAARSKER KMRYIAELER  240
KVQTLQTEAT SLSAQLTLLQ RDTNGLGVEN NELKLRVQTM EQQVHLQDAL NDALKEEVQH  300
LKVLTGQGPS NGTSMNYGSF GSNQQFYPNN QSMHTILAAQ QLQQLQIQSQ KQQQQQQQHQ  360
QQQQQQQQQF HFQQQQLYQL QQQQRLQQQE QQSGASELRR PMPSPGQKES VTSPDRETPL  420
TKD
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.701610.0flower| root| vegetative tissue
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425617410.0
Genevisible260953_at0.0
Expression AtlasAT1G06070-
AtGenExpressAT1G06070-
ATTED-IIAT1G06070-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively at a low level in young seedlings and in roots, stems and leaves of mature plants.
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor with an activatory role.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00126DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G06070.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G43700
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G06070
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ4198540.0AJ419854.1 Arabidopsis thaliana mRNA for AtbZIP transcription factor.
GenBankAK2296660.0AK229666.1 Arabidopsis thaliana mRNA for bZip transcription factor AtbZip69, complete cds, clone: RAFL19-85-B03.
GenBankBT0289650.0BT028965.1 Arabidopsis thaliana At1g06070 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_172097.10.0Basic-leucine zipper (bZIP) transcription factor family protein
SwissprotQ040881e-178POF21_ARATH; Probable transcription factor PosF21
TrEMBLA0A178WMD00.0A0A178WMD0_ARATH; Uncharacterized protein
TrEMBLQ9LNE00.0Q9LNE0_ARATH; At1g06070
STRINGAT1G06070.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24452772
Representative plantOGRP12617181
Publications ? help Back to Top
  1. Eulgem T,Rushton PJ,Robatzek S,Somssich IE
    The WRKY superfamily of plant transcription factors.
    Trends Plant Sci., 2000. 5(5): p. 199-206
    [PMID:10785665]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  4. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  5. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  6. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  7. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  8. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  9. Wagner R,Pfannschmidt T
    Eukaryotic transcription factors in plastids--Bioinformatic assessment and implications for the evolution of gene expression machineries in plants.
    Gene, 2006. 381: p. 62-70
    [PMID:16934950]
  10. Van Leene J, et al.
    Targeted interactomics reveals a complex core cell cycle machinery in Arabidopsis thaliana.
    Mol. Syst. Biol., 2010. 6: p. 397
    [PMID:20706207]
  11. Tsugama D,Liu S,Takano T
    Analysis of functions of VIP1 and its close homologs in osmosensory responses of Arabidopsis thaliana.
    PLoS ONE, 2014. 9(8): p. e103930
    [PMID:25093810]
  12. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]