PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G05230.4
Common NameHDG2, HDGL2-2, YUP8H12.16
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family HD-ZIP
Protein Properties Length: 721aa    MW: 79423.6 Da    PI: 5.7353
Description homeodomain GLABROUS 2
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G05230.4genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.23.3e-1965121157
                  TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
     Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                  +++ +++t+ q++e+e++F+++++p+ ++r++L+++l+L+  qVk+WFqN+R+++k+
  AT1G05230.4  65 KKRYHRHTQLQIQEMEAFFKECPHPDDKQRKQLSRELNLEPLQVKFWFQNKRTQMKN 121
                  688999************************************************995 PP

2START224.72.8e-702524652206
                  HHHHHHHHHHHHHHHC-TT-EEEEEXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEEEEECTT.. CS
        START   2 laeeaaqelvkkalaeepgWvkssesengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetlevissg.. 88 
                  l+ +a++el+++++++ep+W++++  ++++e+ ++f+++ +     +++ea+r+s+vv+m++++ ve+l+d++ qW++ +a    +a+tl+v+s+g  
  AT1G05230.4 252 LSVAAMEELMRMVQVDEPLWKSLV--LDEEEYARTFPRGIGprpagYRSEASRESAVVIMNHVNIVEILMDVN-QWSTIFAgmvsRAMTLAVLSTGva 346
                  56799*******************..************999********************************.************************ PP

                  ....EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHH CS
        START  89 ....galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehvdlkgrlphwll 181
                      galq+m+ae+q++splvp R+ +f+Ry++q+g+g+w++vd+S+ds q++p     +R++++ Sg+li++++ng+skvtwvehv++++r +h+l+
  AT1G05230.4 347 gnynGALQVMSAEFQVPSPLVPtRETYFARYCKQQGDGSWAVVDISLDSLQPNPP----ARCRRRASGCLIQELPNGYSKVTWVEHVEVDDRGVHNLY 440
                  ******************************************************8....*************************************** PP

                  HHHHHHHHHHHHHHHHHHTXXXXXX CS
        START 182 rslvksglaegaktwvatlqrqcek 206
                  +++v++g+a+gak+wva l+rqce+
  AT1G05230.4 441 KHMVSTGHAFGAKRWVAILDRQCER 465
                  ***********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-2144120IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1953122IPR009057Homeodomain-like
PROSITE profilePS5007116.37462122IPR001356Homeobox domain
SMARTSM003896.5E-1863126IPR001356Homeobox domain
PfamPF000468.5E-1765120IPR001356Homeobox domain
CDDcd000869.30E-1965123No hitNo description
PROSITE patternPS00027097120IPR017970Homeobox, conserved site
PROSITE profilePS5084841.633242468IPR002913START domain
SuperFamilySSF559611.53E-32243467No hitNo description
CDDcd088752.81E-122246464No hitNo description
SMARTSM002342.0E-62251465IPR002913START domain
PfamPF018522.1E-63252465IPR002913START domain
Gene3DG3DSA:3.30.530.203.7E-5345431IPR023393START-like domain
SuperFamilySSF559612.05E-26484713No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010090Biological Processtrichome morphogenesis
GO:0048497Biological Processmaintenance of floral organ identity
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000018anatomyovule primordium
PO:0000037anatomyshoot apex
PO:0000084anatomyplant sperm cell
PO:0000229anatomyflower meristem
PO:0000230anatomyinflorescence meristem
PO:0000282anatomytrichome
PO:0000293anatomyguard cell
PO:0004011anatomyinitial cell
PO:0008019anatomyleaf lamina base
PO:0009001anatomyfruit
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0009089anatomyendosperm
PO:0020020anatomynucellus
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020041anatomystipule
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0020148anatomyshoot apical meristem
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001016developmental stageL mature pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007131developmental stageseedling development stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 721 aa     Download sequence    Send to blast
MFEPNMLLAA MNNADSNNHN YNHEDNNNEG FLRDDEFDSP NTKSGSENQE GGSGNDQDPL  60
HPNKKKRYHR HTQLQIQEME AFFKECPHPD DKQRKQLSRE LNLEPLQVKF WFQNKRTQMK  120
NHHERHENSH LRAENEKLRN DNLRYREALA NASCPNCGGP TAIGEMSFDE HQLRLENARL  180
REEIDRISAI AAKYVGKPVS NYPLMSPPPL PPRPLELAMG NIGGEAYGNN PNDLLKSITA  240
PTESDKPVII DLSVAAMEEL MRMVQVDEPL WKSLVLDEEE YARTFPRGIG PRPAGYRSEA  300
SRESAVVIMN HVNIVEILMD VNQWSTIFAG MVSRAMTLAV LSTGVAGNYN GALQVMSAEF  360
QVPSPLVPTR ETYFARYCKQ QGDGSWAVVD ISLDSLQPNP PARCRRRASG CLIQELPNGY  420
SKVTWVEHVE VDDRGVHNLY KHMVSTGHAF GAKRWVAILD RQCERLASVM ATNISSGEVG  480
VITNQEGRRS MLKLAERMVI SFCAGVSAST AHTWTTLSGT GAEDVRVMTR KSVDDPGRPP  540
GIVLSAATSF WIPVPPKRVF DFLRDENSRN EWDILSNGGV VQEMAHIANG RDTGNCVSLL  600
RVNSANSSQS NMLILQESCT DPTASFVIYA PVDIVAMNIV LNGGDPDYVA LLPSGFAILP  660
DGNANSGAPG GDGGSLLTVA FQILVDSVPT AKLSLGSVAT VNNLIACTVE RIKASMSCET  720
A
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.191790.0flower| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264582_at0.0
Expression AtlasAT1G05230-
AtGenExpressAT1G05230-
ATTED-IIAT1G05230-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in hairless cell files of the hypocotyl epidermis. Expressed in shoot apical meristem (SAM) with higher levels in L1 cells and the epidermal layer of young leaves. Expressed in primary root tips, in the L1 of apical inflorescence meristems, early flower primordia, carpel epidermis, ovule primordia, nucellus, chalaze and seed coat. {ECO:0000269|PubMed:16778018}.
Functional Description ? help Back to Top
Source Description
TAIREncodes a homeobox-leucine zipper family protein belonging to the HD-ZIP IV family. Mutants have trichomes that appear glass-like under a dissecting microscope as compared to the wild-type trichomes. The mutations do not affect trichome growth or branch number.
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. HDG2 gene is required for normal gl3-sst sim trichome development.
    [PMID: 19626137]
  2. HDG2 overexpression confers differentiation of ectopic stomata in internal mesophyll tissues.
    [PMID: 23515473]
  3. HDG2 is involved in determining the identity of petals and stamens.
    [PMID: 23590515]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G05230.4
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G05230
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3167760.0AK316776.1 Arabidopsis thaliana AT1G05230 mRNA, complete cds, clone: RAFL09-78-H10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001184911.10.0homeodomain GLABROUS 2
RefseqNP_001322673.10.0homeodomain GLABROUS 2
RefseqNP_001322674.10.0homeodomain GLABROUS 2
RefseqNP_001322675.10.0homeodomain GLABROUS 2
RefseqNP_001322676.10.0homeodomain GLABROUS 2
RefseqNP_001322677.10.0homeodomain GLABROUS 2
RefseqNP_001322678.10.0homeodomain GLABROUS 2
RefseqNP_001322680.10.0homeodomain GLABROUS 2
RefseqNP_172015.10.0homeodomain GLABROUS 2
RefseqNP_849596.10.0homeodomain GLABROUS 2
SwissprotQ94C370.0HDG2_ARATH; Homeobox-leucine zipper protein HDG2
TrEMBLB9DFH80.0B9DFH8_ARATH; AT1G05230 protein
STRINGAT1G05230.40.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Tavares R,Aubourg S,Lecharny A,Kreis M
    Organization and structural evolution of four multigene families in Arabidopsis thaliana: AtLCAD, AtLGT, AtMYST and AtHD-GL2.
    Plant Mol. Biol., 2000. 42(5): p. 703-17
    [PMID:10809443]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  4. Schrick K,Nguyen D,Karlowski WM,Mayer KF
    START lipid/sterol-binding domains are amplified in plants and are predominantly associated with homeodomain transcription factors.
    Genome Biol., 2004. 5(6): p. R41
    [PMID:15186492]
  5. Nakamura M, et al.
    Characterization of the class IV homeodomain-Leucine Zipper gene family in Arabidopsis.
    Plant Physiol., 2006. 141(4): p. 1363-75
    [PMID:16778018]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Fleury D, et al.
    The Arabidopsis thaliana homolog of yeast BRE1 has a function in cell cycle regulation during early leaf and root growth.
    Plant Cell, 2007. 19(2): p. 417-32
    [PMID:17329565]
  8. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  9. Marks MD,Wenger JP,Gilding E,Jilk R,Dixon RA
    Transcriptome analysis of Arabidopsis wild-type and gl3-sst sim trichomes identifies four additional genes required for trichome development.
    Mol Plant, 2009. 2(4): p. 803-22
    [PMID:19626137]
  10. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  11. Peterson KM, et al.
    Arabidopsis homeodomain-leucine zipper IV proteins promote stomatal development and ectopically induce stomata beyond the epidermis.
    Development, 2013. 140(9): p. 1924-35
    [PMID:23515473]
  12. Kamata N,Okada H,Komeda Y,Takahashi T
    Mutations in epidermis-specific HD-ZIP IV genes affect floral organ identity in Arabidopsis thaliana.
    Plant J., 2013. 75(3): p. 430-40
    [PMID:23590515]