PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G03970.1
Common NameBZIP40, F21M11.10, GBF4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bZIP
Protein Properties Length: 270aa    MW: 30586.2 Da    PI: 5.7461
Description G-box binding factor 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G03970.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_158.31.7e-18186247263
                  XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                  ++ +r++r++kNRe+A rsR+RK+a++ eLe+ +++Le+eN++L ke+ee +ke +k  +ev
  AT1G03970.1 186 AAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKERYKKLMEV 247
                  5789***************************************************9988875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.3E-14184240No hitNo description
SMARTSM003381.3E-14185249IPR004827Basic-leucine zipper domain
PfamPF001701.1E-17186247IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.277187239IPR004827Basic-leucine zipper domain
CDDcd147074.39E-18189235No hitNo description
SuperFamilySSF579591.38E-10189241No hitNo description
PROSITE patternPS000360192207IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MASFKLMSSS NSDLSRRNSS SASSSPSIRS SHHLRPNPHA DHSRISFAYG GGVNDYTFAS  60
DSKPFEMAID VDRSIGDRNS VNNGKSVDDV WKEIVSGEQK TIMMKEEEPE DIMTLEDFLA  120
KAEMDEGASD EIDVKIPTER LNNDGSYTFD FPMQRHSSFQ MVEGSMGGGV TRGKRGRVMM  180
EAMDKAAAQR QKRMIKNRES AARSRERKQA YQVELETLAA KLEEENEQLL KEIEESTKER  240
YKKLMEVLIP VDEKPRPPSR PLSRSHSLEW
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.266640.0flower| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible265040_at0.0
Expression AtlasAT1G03970-
AtGenExpressAT1G03970-
Functional Description ? help Back to Top
Source Description
TAIRencodes a basic leucine zipper G-box binding factor that can bind to G-box motifs only as heterodimers with GBF2 or GBF3. A single amino acid change can confer G-box binding as homodimers.
UniProtBinds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G03970.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G03970
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0030270.0AC003027.1 Arabidopsis thaliana chromosome I BAC F21M11 genomic sequence, complete sequence.
GenBankCP0026840.0CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
GenBankBT0244950.0BT024495.1 Arabidopsis thaliana At1g03970 mRNA, complete cds.
GenBankAY0876030.0AY087603.1 Arabidopsis thaliana clone 36980 mRNA, complete sequence.
GenBankU018230.0U01823.1 Arabidopsis thaliana Columbia bZIP protein GBF4 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_171893.10.0G-box binding factor 4
SwissprotP427770.0GBF4_ARATH; G-box-binding factor 4
TrEMBLQ2HIT60.0Q2HIT6_ARATH; At1g03970
STRINGAT1G03970.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38522855
Representative plantOGRP8662715
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jakoby M, et al.
    bZIP transcription factors in Arabidopsis.
    Trends Plant Sci., 2002. 7(3): p. 106-11
    [PMID:11906833]
  3. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  4. Goda H, et al.
    Comprehensive comparison of auxin-regulated and brassinosteroid-regulated genes in Arabidopsis.
    Plant Physiol., 2004. 134(4): p. 1555-73
    [PMID:15047898]
  5. Deppmann CD, et al.
    Dimerization specificity of all 67 B-ZIP motifs in Arabidopsis thaliana: a comparison to Homo sapiens B-ZIP motifs.
    Nucleic Acids Res., 2004. 32(11): p. 3435-45
    [PMID:15226410]
  6. Fey V, et al.
    Retrograde plastid redox signals in the expression of nuclear genes for chloroplast proteins of Arabidopsis thaliana.
    J. Biol. Chem., 2005. 280(7): p. 5318-28
    [PMID:15561727]
  7. Deppmann CD,Alvania RS,Taparowsky EJ
    Cross-species annotation of basic leucine zipper factor interactions: Insight into the evolution of closed interaction networks.
    Mol. Biol. Evol., 2006. 23(8): p. 1480-92
    [PMID:16731568]
  8. Cheng C, et al.
    An early response regulatory cluster induced by low temperature and hydrogen peroxide in seedlings of chilling-tolerant japonica rice.
    BMC Genomics, 2007. 8: p. 175
    [PMID:17577400]
  9. Ascencio-Ib
    Global analysis of Arabidopsis gene expression uncovers a complex array of changes impacting pathogen response and cell cycle during geminivirus infection.
    Plant Physiol., 2008. 148(1): p. 436-54
    [PMID:18650403]
  10. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  11. Menkens AE,Cashmore AR
    Isolation and characterization of a fourth Arabidopsis thaliana G-box-binding factor, which has similarities to Fos oncoprotein.
    Proc. Natl. Acad. Sci. U.S.A., 1994. 91(7): p. 2522-6
    [PMID:8146148]
  12. Terzaghi WB,Bertekap RL,Cashmore AR
    Intracellular localization of GBF proteins and blue light-induced import of GBF2 fusion proteins into the nucleus of cultured Arabidopsis and soybean cells.
    Plant J., 1997. 11(5): p. 967-82
    [PMID:9193069]