PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G01720.1
Common NameANAC002, ATAF1, NAC002, T1N6.12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family NAC
Protein Properties Length: 289aa    MW: 32922.3 Da    PI: 6.5265
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G01720.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.16e-5271311128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                  lppGfrFhPtdeelv++yL++k++++++ +  +i+e+d+yk++Pw+Lp  +  +ekewyfFs+rd+ky++g+r+nr++ sgyWkatg dk++     +
  AT1G01720.1   7 LPPGFRFHPTDEELVMHYLCRKCASQSIAV-PIIAEIDLYKYDPWELPGLALYGEKEWYFFSPRDRKYPNGSRPNRSAGSGYWKATGADKPIGL--PK 101
                  79*************************999.88***************6555679*************************************99..78 PP

          NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                   vg+kk Lvfy g+apkgekt+W+mheyrl
  AT1G01720.1 102 PVGIKKALVFYAGKAPKGEKTNWIMHEYRL 131
                  9***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.89E-624158IPR003441NAC domain
PROSITE profilePS5100560.2877158IPR003441NAC domain
PfamPF023651.5E-278131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0009611Biological Processresponse to wounding
GO:0009788Biological Processnegative regulation of abscisic acid-activated signaling pathway
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009052anatomyflower pedicel
PO:0020030anatomycotyledon
PO:0020038anatomypetiole
PO:0020100anatomyhypocotyl
PO:0020137anatomyleaf apex
PO:0025022anatomycollective leaf structure
PO:0025195anatomypollen tube cell
PO:0025281anatomypollen
PO:0001017developmental stageM germinated pollen stage
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007095developmental stageLP.08 eight leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007115developmental stageLP.04 four leaves visible stage
PO:0007123developmental stageLP.06 six leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MSELLQLPPG FRFHPTDEEL VMHYLCRKCA SQSIAVPIIA EIDLYKYDPW ELPGLALYGE  60
KEWYFFSPRD RKYPNGSRPN RSAGSGYWKA TGADKPIGLP KPVGIKKALV FYAGKAPKGE  120
KTNWIMHEYR LADVDRSVRK KKNSLRLDDW VLCRIYNKKG ATERRGPPPP VVYGDEIMEE  180
KPKVTEMVMP PPPQQTSEFA YFDTSDSVPK LHTTDSSCSE QVVSPEFTSE VQSEPKWKDW  240
SAVSNDNNNT LDFGFNYIDA TVDNAFGGGG SSNQMFPLQD MFMYMQKPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A5e-79516413174Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.1340.0flower| inflorescence| leaf| root| seed
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible261564_at0.0
Expression AtlasAT1G01720-
AtGenExpressAT1G01720-
ATTED-IIAT1G01720-
Functional Description ? help Back to Top
Source Description
TAIRBelongs to a large family of putative transcriptional activators with NAC domain. Transcript level increases in response to wounding and abscisic acid. ATAF1 attentuates ABA signaling and sythesis. Mutants are hyposensitive to ABA.
Function -- GeneRIF ? help Back to Top
  1. ATAF1-dependent repression of abscisic acid biosynthesis and signalling is a central component of Arabidopsis penetration resistance towards Blumeria attack.
    [PMID: 18694460]
  2. Expression of ATAF1 was downregulated after infection with Botrytis cinerea or Pseudomonas syringae pv. tomato.
    [PMID: 19737096]
  3. ATAF1, Arabidopsis NAC gene, is a bona fide regulator modulating plant responses to many abiotic stresses and necrotrophic-pathogen infection.
    [PMID: 19752887]
  4. ATAF1 serves as a core transcriptional activator of senescence by coupling stress-related signaling with photosynthesis- and senescence-related transcriptional cascades.
    [PMID: 25953103]
  5. TREHALASE1, the only trehalase-encoding gene in Arabidopsis, was identified as a direct downstream target of ATAF1.
    [PMID: 26149570]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00121DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G01720.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G01720
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0245130.0BT024513.1 Arabidopsis thaliana At1g01720 mRNA, complete cds.
GenBankX747550.0X74755.1 A.thaliana ATAF1 mRNA.
GenBankAF3706170.0AF370617.1 Arabidopsis thaliana OsNAC6 protein-like protein (T1N6.12) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_171677.10.0putative transcriptional activator with NAC domain
SwissprotQ390130.0NAC2_ARATH; NAC domain-containing protein 2
TrEMBLQ2HIR80.0Q2HIR8_ARATH; At1g01720
STRINGAT1G01720.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19028276
Representative plantOGRP1715800
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Collinge M,Boller T
    Differential induction of two potato genes, Stprx2 and StNAC, in response to infection by Phytophthora infestans and to wounding.
    Plant Mol. Biol., 2001. 46(5): p. 521-9
    [PMID:11516145]
  3. Greve K,La Cour T,Jensen MK,Poulsen FM,Skriver K
    Interactions between plant RING-H2 and plant-specific NAC (NAM/ATAF1/2/CUC2) proteins: RING-H2 molecular specificity and cellular localization.
    Biochem. J., 2003. 371(Pt 1): p. 97-108
    [PMID:12646039]
  4. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  5. Hegedus D, et al.
    Molecular characterization of Brassica napus NAC domain transcriptional activators induced in response to biotic and abiotic stress.
    Plant Mol. Biol., 2003. 53(3): p. 383-97
    [PMID:14750526]
  6. Ooka H, et al.
    Comprehensive analysis of NAC family genes in Oryza sativa and Arabidopsis thaliana.
    DNA Res., 2003. 10(6): p. 239-47
    [PMID:15029955]
  7. Avivi Y, et al.
    Reorganization of specific chromosomal domains and activation of silent genes in plant cells acquiring pluripotentiality.
    Dev. Dyn., 2004. 230(1): p. 12-22
    [PMID:15108305]
  8. Lu PL, et al.
    A novel drought-inducible gene, ATAF1, encodes a NAC family protein that negatively regulates the expression of stress-responsive genes in Arabidopsis.
    Plant Mol. Biol., 2007. 63(2): p. 289-305
    [PMID:17031511]
  9. Kim YS, et al.
    A membrane-bound NAC transcription factor regulates cell division in Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3132-44
    [PMID:17098812]
  10. Zhong R,Demura T,Ye ZH
    SND1, a NAC domain transcription factor, is a key regulator of secondary wall synthesis in fibers of Arabidopsis.
    Plant Cell, 2006. 18(11): p. 3158-70
    [PMID:17114348]
  11. Jensen MK, et al.
    The HvNAC6 transcription factor: a positive regulator of penetration resistance in barley and Arabidopsis.
    Plant Mol. Biol., 2007. 65(1-2): p. 137-50
    [PMID:17619150]
  12. Jensen MK, et al.
    Transcriptional regulation by an NAC (NAM-ATAF1,2-CUC2) transcription factor attenuates ABA signalling for efficient basal defence towards Blumeria graminis f. sp. hordei in Arabidopsis.
    Plant J., 2008. 56(6): p. 867-80
    [PMID:18694460]
  13. Wang Y, et al.
    Transcriptome analyses show changes in gene expression to accompany pollen germination and tube growth in Arabidopsis.
    Plant Physiol., 2008. 148(3): p. 1201-11
    [PMID:18775970]
  14. Kunieda T, et al.
    NAC family proteins NARS1/NAC2 and NARS2/NAM in the outer integument regulate embryogenesis in Arabidopsis.
    Plant Cell, 2008. 20(10): p. 2631-42
    [PMID:18849494]
  15. Yoshiyama K,Conklin PA,Huefner ND,Britt AB
    Suppressor of gamma response 1 (SOG1) encodes a putative transcription factor governing multiple responses to DNA damage.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(31): p. 12843-8
    [PMID:19549833]
  16. Kim SG,Park CM
    Membrane-mediated salt stress signaling in flowering time control.
    Plant Signal Behav, 2007. 2(6): p. 517-8
    [PMID:19704545]
  17. Wang X, et al.
    The Arabidopsis ATAF1, a NAC transcription factor, is a negative regulator of defense responses against necrotrophic fungal and bacterial pathogens.
    Mol. Plant Microbe Interact., 2009. 22(10): p. 1227-38
    [PMID:19737096]
  18. Wu Y, et al.
    Dual function of Arabidopsis ATAF1 in abiotic and biotic stress responses.
    Cell Res., 2009. 19(11): p. 1279-90
    [PMID:19752887]
  19. Abdeen A,Schnell J,Miki B
    Transcriptome analysis reveals absence of unintended effects in drought-tolerant transgenic plants overexpressing the transcription factor ABF3.
    BMC Genomics, 2010. 11: p. 69
    [PMID:20105335]
  20. Hanada K, et al.
    Functional compensation of primary and secondary metabolites by duplicate genes in Arabidopsis thaliana.
    Mol. Biol. Evol., 2011. 28(1): p. 377-82
    [PMID:20736450]
  21. Wang H, et al.
    Mutation of WRKY transcription factors initiates pith secondary wall formation and increases stem biomass in dicotyledonous plants.
    Proc. Natl. Acad. Sci. U.S.A., 2010. 107(51): p. 22338-43
    [PMID:21135241]
  22. Lee S,Park CM
    Regulation of reactive oxygen species generation under drought conditions in Arabidopsis.
    Plant Signal Behav, 2012. 7(6): p. 599-601
    [PMID:22580707]
  23. Li DM,Wang JH,Peng SL,Zhu GF,L
    Molecular cloning and characterization of two novel NAC genes from Mikania micrantha (Asteraceae).
    Genet. Mol. Res., 2012. 11(4): p. 4383-401
    [PMID:23079980]
  24. Lumba S, et al.
    A mesoscale abscisic acid hormone interactome reveals a dynamic signaling landscape in Arabidopsis.
    Dev. Cell, 2014. 29(3): p. 360-72
    [PMID:24823379]
  25. Jin J, et al.
    An Arabidopsis Transcriptional Regulatory Map Reveals Distinct Functional and Evolutionary Features of Novel Transcription Factors.
    Mol. Biol. Evol., 2015. 32(7): p. 1767-73
    [PMID:25750178]
  26. Garapati P,Xue GP,Munn
    Transcription Factor ATAF1 in Arabidopsis Promotes Senescence by Direct Regulation of Key Chloroplast Maintenance and Senescence Transcriptional Cascades.
    Plant Physiol., 2015. 168(3): p. 1122-39
    [PMID:25953103]
  27. Garapati P, et al.
    Transcription Factor Arabidopsis Activating Factor1 Integrates Carbon Starvation Responses with Trehalose Metabolism.
    Plant Physiol., 2015. 169(1): p. 379-90
    [PMID:26149570]