PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G01520.1
Common NameASG4, F22L4.18, LCL3, RVE3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB_related
Protein Properties Length: 287aa    MW: 32795.5 Da    PI: 10.1809
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G01520.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding445.2e-1461105147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT++E++++++a +++  + Wk+I + +g  +t  q++s+ qky
      AT1G01520.1  61 RENWTEQEHDKFLEALHLFDRD-WKKIKAFVG-SKTVIQIRSHAQKY 105
                      789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.5E-1655111IPR009057Homeodomain-like
PROSITE profilePS5129415.61656110IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.4E-759111IPR009057Homeodomain-like
TIGRFAMsTIGR015573.0E-1759108IPR006447Myb domain, plants
SMARTSM007173.7E-1160108IPR001005SANT/Myb domain
PfamPF002497.1E-1261105IPR001005SANT/Myb domain
CDDcd001675.61E-963106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009029anatomystamen
PO:0009047anatomystem
PO:0007611developmental stagepetal differentiation and expansion stage
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MVTVNPSQAH CLPMKMSLPG FNTLPHTATT IPVSIRSNRT MSFFEDPTKK VRKPYTITKS  60
RENWTEQEHD KFLEALHLFD RDWKKIKAFV GSKTVIQIRS HAQKYFLKVQ KNGTKEHLPP  120
PRPKRKANHP YPQKAPKFTL SSSNALFQHD YLYNTNSHPV ISTTRKHGLV HCDVSIPSSV  180
IKEEFGVSEN CCSTSSSRDK QRTRIVTETN DQESCGKPHR VAPNFAEVYN FIGSVFDPKT  240
TGHVKRLKEM DPINLETVLL LMKNLSVNLT SPEFDEQRKL ISSYNAS
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO183788490.0
Genevisible259432_at0.0
Expression AtlasAT1G01520-
AtGenExpressAT1G01520-
ATTED-IIAT1G01520-
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. REVEILLE clock genes rve3 4 5 6 8 mutants are much larger than wild-type plants, with both increased leaf area and biomass.
    [PMID: 28254761]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G01520.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q6R0H0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G01520
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ9372110.0AJ937211.1 Arabidopsis thaliana mRNA for myb transcription factor LHY-CCA1-like3 (lcl3 gene).
GenBankAY5195080.0AY519508.1 Arabidopsis thaliana MYB transcription factor (At1g01520) mRNA, complete cds.
GenBankBT0293470.0BT029347.1 Arabidopsis thaliana At1g01520 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_171659.10.0Homeodomain-like superfamily protein
SwissprotQ6R0H00.0RVE3_ARATH; Protein REVEILLE 3
TrEMBLA0A178W6720.0A0A178W672_ARATH; ASG4
STRINGAT1G01520.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12902893
Representative plantOGRP9281558
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Dal Bosco C, et al.
    Inactivation of the chloroplast ATP synthase gamma subunit results in high non-photochemical fluorescence quenching and altered nuclear gene expression in Arabidopsis thaliana.
    J. Biol. Chem., 2004. 279(2): p. 1060-9
    [PMID:14576160]
  3. S
    ABA activates ADPR cyclase and cADPR induces a subset of ABA-responsive genes in Arabidopsis.
    Plant J., 2004. 38(3): p. 381-95
    [PMID:15086800]
  4. Nagata T,Yamada H,Du Z,Todoriki S,Kikuchi S
    Microarray analysis of genes that respond to gamma-irradiation in Arabidopsis.
    J. Agric. Food Chem., 2005. 53(4): p. 1022-30
    [PMID:15713015]
  5. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  6. Oravecz A, et al.
    CONSTITUTIVELY PHOTOMORPHOGENIC1 is required for the UV-B response in Arabidopsis.
    Plant Cell, 2006. 18(8): p. 1975-90
    [PMID:16829591]
  7. Manfield IW, et al.
    Arabidopsis Co-expression Tool (ACT): web server tools for microarray-based gene expression analysis.
    Nucleic Acids Res., 2006. 34(Web Server issue): p. W504-9
    [PMID:16845059]
  8. Xin Z,Mandaokar A,Chen J,Last RL,Browse J
    Arabidopsis ESK1 encodes a novel regulator of freezing tolerance.
    Plant J., 2007. 49(5): p. 786-99
    [PMID:17316173]
  9. Rawat R, et al.
    REVEILLE1, a Myb-like transcription factor, integrates the circadian clock and auxin pathways.
    Proc. Natl. Acad. Sci. U.S.A., 2009. 106(39): p. 16883-8
    [PMID:19805390]
  10. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]
  11. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  12. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]
  13. Huang KC,Lin WC,Cheng WH
    Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
    BMC Plant Biol., 2018. 18(1): p. 40
    [PMID:29490615]
  14. Terryn N, et al.
    Sequence analysis of a 40-kb Arabidopsis thaliana genomic region located at the top of chromosome 1.
    Gene, 1998. 215(1): p. 11-7
    [PMID:9666060]