PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33573
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 266aa    MW: 29524.7 Da    PI: 8.7356
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33573genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like48.61.8e-157362655
   G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
              +AtPktil++m+vkgLtl h+kSHLQkYR+
  EMT33573  7 EATPKTILRTMGVKGLTLFHLKSHLQKYRM 36
              7****************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.27E-5637IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-10737IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.5E-13737IPR009057Homeodomain-like
PfamPF143797.4E-20141186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 266 aa     Download sequence    Send to blast
MDDSHGEATP KTILRTMGVK GLTLFHLKSH LQKYRMGKQT GKETPEQSKD VWTRFSVCCK  60
EPLSANFLKA SRYTALAVDA IPSNCSPHTA VHVYCVMVNM NHKFCNDFMK KFRTRSYLLD  120
AQGGMSLSPR VSTQDAKESQ EVKEALRAQM EMQRSLHEQV EVQKHVDIRM DAYTTYINTL  180
LEKACKIVSE QFASSGFSVS DQSLPELSSG GIMCGTATDA LSSSVFHQLS VSSINMHSPG  240
GKPSPSGMEG QLLLQRSPEF KRKSSC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3636650.0AK363665.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2017P09.
GenBankAK3673540.0AK367354.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2055J10.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020195363.11e-103protein PHR1-LIKE 2-like isoform X2
RefseqXP_020195364.11e-103protein PHR1-LIKE 2-like isoform X2
RefseqXP_020195365.11e-103protein PHR1-LIKE 2-like isoform X2
RefseqXP_020195366.11e-103protein PHR1-LIKE 2-like isoform X2
RefseqXP_020195367.11e-103protein PHR1-LIKE 2-like isoform X2
TrEMBLN1R4H30.0N1R4H3_AEGTA; Myb family transcription factor APL
STRINGEMT335730.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP34273873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.12e-22G2-like family protein