PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33395
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 514aa    MW: 57239 Da    PI: 7.1303
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33395genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like80.42.2e-25140194156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               kpr+ Wt  LH++F+ea++q+ G ++A+Pk+ilelm+v+ L++e+++SHLQkYRl+
  EMT33395 140 KPRMTWTIALHNKFLEAINQI-GLDRAVPKKILELMNVDYLSRENIASHLQKYRLH 194
               79*******************.********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.137183IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23001.8E-51146No hitNo description
SuperFamilySSF521721.57E-91686IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23009.5E-747103No hitNo description
PROSITE profilePS512949.272137196IPR017930Myb domain
SuperFamilySSF466891.43E-18138197IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.5E-26139198IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24140194IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 514 aa     Download sequence    Send to blast
MATMSGDRAA EDKFPEGLRV LVVDDDRVCL KVLEALLRHC KYQLLSVDCD KKVVMKGIDH  60
GASDFMVKPV RTHELKNIWQ HVQRWRNPKA ISHISDHDND VQRVQPATTD KSKYSGNKRN  120
VGDDSSENNE GTHISAIHRK PRMTWTIALH NKFLEAINQI GLDRAVPKKI LELMNVDYLS  180
RENIASHLQK YRLHLKRVKS NPSGDAYERW NSSYNMNNKG NFMHNHEHGR WIVSFGDTAS  240
WSTNKYGSTG HLAPPMNIQS NLYMGSYLHD GRMPKYVGKL PSDARRFTGF ADPPVSLYDN  300
IPNKIMSDEF PSFNYSNSCS DIMRGKLMEI SKGKSPSILQ SSFANTTVGG GRSLVASQVN  360
FPHSNQLESY AMSSGRLPLQ NEKTPFISNT TSVGGFTEQM APFNIASNIS SVGTMLNGSS  420
ALDASRTSTN DTHLGNGGRT TSMLHNLQTD DFVSLTRLHD GGDGASIVPT QEGTLNQQPL  480
NDHLNEISAF SMDDIFSNMH VEDFTGDDAI VEEA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A4e-22138198363ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020182593.10.0two-component response regulator ORR24-like
RefseqXP_020199001.10.0two-component response regulator ORR24-like
TrEMBLN1R5L30.0N1R5L3_AEGTA; Two-component response regulator ARR12
STRINGEMT333950.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP15285415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G25180.15e-37response regulator 12