PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT33003
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 408aa    MW: 43465.8 Da    PI: 9.3552
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT33003genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1683.2e-52331651128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...... 95 
               lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk++l++      
  EMT33003  33 LPPGFRFHPTDEELVVHYLKKKAAKVPLPV-TIIAEVDLYKFDPWELPEKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPILASgtgcgl 132
               79****************************.89***************988899****************************************9877777 PP

       NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                +e+ g+kk Lvfy+g+ pkg kt+W+mheyrl
  EMT33003 133 VREKLGVKKALVFYRGKPPKGLKTNWIMHEYRL 165
               6677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-6130206IPR003441NAC domain
PROSITE profilePS5100559.72933206IPR003441NAC domain
PfamPF023652.3E-2734165IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGSSDSSSGS AQKAARHQHE PPPPRQRGSA PELPPGFRFH PTDEELVVHY LKKKAAKVPL  60
PVTIIAEVDL YKFDPWELPE KATFGEQEWY FFSPRDRKYP NGARPNRAAT SGYWKATGTD  120
KPILASGTGC GLVREKLGVK KALVFYRGKP PKGLKTNWIM HEYRLTDASG STTTSRPPPP  180
PPVTGGSRAA ASLRLDDWVL CRIYKKINKA AAGDQQRSME CEDSVEDAVT AYPLYATAGM  240
AGAGAHGSNY ASSSLLHHQD SHFLDGLFTA DDAGLSAGAT SLSHLAAAAR ASPAPTKQFL  300
APSSSTPFNW LEASAAGILP QARNFPGFNR SRNVGNMSLS STADMAGAAG NAVNAMSAFM  360
NPLPVQDGTY HQHHVILGAP LAPEATAGAA TSGFQHHAVQ ISGVNWNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-72252095171Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-B2) and one extra pseudogene (NAM-B1) (PubMed:17124321). {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM8208890.0KM820889.1 Triticum aestivum cultivar Chinese Spring NAC transcription factor NAM-D1 (NAM-D1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020187501.10.0NAC transcription factor NAM-A1
SwissprotA0SPJ30.0NAMA1_TRITD; NAC transcription factor NAM-A1
TrEMBLA0A3B6QB090.0A0A3B6QB09_WHEAT; Uncharacterized protein
TrEMBLA0A453N9530.0A0A453N953_AEGTS; Uncharacterized protein
TrEMBLF8SJ360.0F8SJ36_WHEAT; NAC transcription factor NAM-D1
TrEMBLM8CFK30.0M8CFK3_AEGTA; NAC domain-containing protein 18
STRINGEMT330030.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75723649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.11e-87NAC domain containing protein 25
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]