PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT32911
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 581aa    MW: 64719.6 Da    PI: 5.1513
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT32911genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS271.52.7e-832645792317
      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
               ++lL++cAeav s+d + a++lL+r++ ++sp+gd+ qRla+yft++L+arla+++s+ly++l  ++ts   + e + a++l   +s  +k++ l   ++I
  EMT32911 264 ETLLTRCAEAVVSNDVRGASKLLERIKCHSSPTGDARQRLAHYFTQGLEARLAGTGSRLYRSLMGKRTS---VLELIRAFHLHEAASCSIKVGLLFSTNTI 361
               689************************************************************999999...9**************************** PP

      GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
               ++av+g +++Hi+ +++s G+QWp Ll+ La+R++gpp++RiTg++ p +g      ++e g+rL++ A+++gvpf+f++ +a++ ed++ eeL+++p+E+
  EMT32911 362 YKAVAGRRKLHIVHYGMSTGFQWPDLLRLLANREGGPPEVRITGINTPLPGpcPDALMQEAGHRLNNCASQFGVPFKFRA-IASKPEDVRAEELHIDPDEV 461
               ************************************************9999899999**********************.79****************** PP

      GRAS 202 laVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
               l+V++ ++  +l+des++ +   +rd vL+++++++P v++ +  +  ++++ F++rf +al+y++alfd +e+++pr+  er  vEr +l+r++ n++ac
  EMT32911 462 LVVSSLYEFRTLMDESLTFDMvsPRDMVLNTIRKMRPSVFISSVVNGPYSAAFFMTRFRHALYYFTALFDVMETTVPRDGGERLLVERDILARSAINMIAC 562
               ***************98765555****************************************************************************** PP

      GRAS 301 egaerrerhetlekWre 317
               eg++r+er +++++W++
  EMT32911 563 EGTDRVERPQNYKEWQD 579
               ***************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098552.332237581IPR005202Transcription factor GRAS
PfamPF035149.4E-81264579IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 581 aa     Download sequence    Send to blast
MAATPEELLG LAEPAPLSPS VFLDLPPTTH GDSQNDLALE YISRMLTEED IVDKFFYQYP  60
DHPKLLQAEQ PFAEILADTS SSAAQESFAS STSILMPSQG NNTDVMVSGC QVQDPVFLNG  120
TGTVEPNGMV FPSESSTSMN MLSSMEFFKG MEEANMFLPT YDVMVDGRGR KKRSVMDGEA  180
EAGLGRSSKQ IVVLLHSTTT LEEEEATALE MLDRLILNGY EACPSEMQEV VRVTWEDKED  240
KAARQSISRR GRRGARHTVV TDLETLLTRC AEAVVSNDVR GASKLLERIK CHSSPTGDAR  300
QRLAHYFTQG LEARLAGTGS RLYRSLMGKR TSVLELIRAF HLHEAASCSI KVGLLFSTNT  360
IYKAVAGRRK LHIVHYGMST GFQWPDLLRL LANREGGPPE VRITGINTPL PGPCPDALMQ  420
EAGHRLNNCA SQFGVPFKFR AIASKPEDVR AEELHIDPDE VLVVSSLYEF RTLMDESLTF  480
DMVSPRDMVL NTIRKMRPSV FISSVVNGPY SAAFFMTRFR HALYYFTALF DVMETTVPRD  540
GGERLLVERD ILARSAINMI ACEGTDRVER PQNYKEWQDD Q
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A1e-332635785315GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575608.30.0PREDICTED: scarecrow-like protein 33
TrEMBLM8D8R50.0M8D8R5_AEGTA; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G29060.17e-95GRAS family protein