PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28996
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 480aa    MW: 52617.5 Da    PI: 8.7532
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28996genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.41.2e-31205260156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               k+r++W+peLH++Fv a++qLGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  EMT28996 205 KTRRCWSPELHRHFVAALHQLGGPQVATPKQIREMMKVDGLTNDEVKSHLQKYRLH 260
               68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.5E-28202263IPR009057Homeodomain-like
PROSITE profilePS5129413.823202262IPR017930Myb domain
SuperFamilySSF466891.79E-16203263IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-25205260IPR006447Myb domain, plants
PfamPF002493.6E-7207258IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010092Biological Processspecification of organ identity
GO:0010629Biological Processnegative regulation of gene expression
GO:0048449Biological Processfloral organ formation
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MPLDLGLDLK LFVAKTAGRL AAAAKEAPAV DACIRGLEEE RRKIEVFRRE LPLCARLLAD  60
VIEFMKEEAA KRSERRDADD NDKRKWMSTA QLWVDSRATD AADPVKEQRK ESALSKPMLL  120
GGAIGAPMAA SCRAMPPPAA PQYFGRGDKI VGTQGLPALP MISPAANRQF SPPVDDRHQA  180
IAAKFAAPMP PPGPGLQTHD QQSRKTRRCW SPELHRHFVA ALHQLGGPQV ATPKQIREMM  240
KVDGLTNDEV KSHLQKYRLH NQRCPSSSSA SHPVMLVGDL WAHQEQSSSQ SRSPEGPLQL  300
SVSGVAVSAL TGSDSSEEDG SVNLVLPAEL PFSDQQQHVS IAAKPRSSEP KELKDKSAMV  360
ALSVFSFAWR PRLNRAILFC NCVSVVVCSS PSVPRVPFAA GWGALALGAA ISLFLESSGK  420
REFLFQDDRV ILPPFLNCSC ILRGNLLLYS DYGEVFRNKL LILSEGFDLQ CKMTVWRTDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-14205263260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00475DAPTransfer from AT4G37180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519440.0JF951944.1 Triticum aestivum clone TaMYB61 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020199780.10.0uncharacterized protein LOC109785601
TrEMBLM8CYP10.0M8CYP1_AEGTA; Two-component response regulator ARR2
STRINGEMT289960.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.18e-41G2-like family protein