PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT28079
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 479aa    MW: 51040.2 Da    PI: 7.6198
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT28079genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.16.1e-31108161255
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               prlrWtp+LH +F++ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  EMT28079 108 PRLRWTPDLHMAFLHAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 161
               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.56104164IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-28104162IPR009057Homeodomain-like
SuperFamilySSF466891.97E-14106162IPR009057Homeodomain-like
TIGRFAMsTIGR015571.8E-22108163IPR006447Myb domain, plants
PfamPF002499.3E-9109160IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MGEVKEKEAL AAEILEDHRK GSSDDSLPPT GLDLNQGFSE GSDDGGDGDE NYDDDGGSTS  60
EVAGGGRSSS NKNSANHESE SSRGRHDKAE GSGERVPTVR QYNRSKHPRL RWTPDLHMAF  120
LHAVERLGGQ ERATPKLVLQ MMNVRGLSIA HVKSHLQMYR SKKIEHESSH ERAAMSSVFS  180
PMNFHMRRGD HPFHDMFFQR AAGSTLSSRN QEWAFTQHAA AARARAVNDN GPGKGLIHEM  240
IFRKDGKPTS HLFDVRDAAA SSGTTSPSTT TTSQADRRPD GAKMGSMNWI GSSSRPVSKT  300
MSATGLEQGG HAQLPFRWRG AAGSNGCHPN GNTGRTTSSS DPVVTCEAGS PLLLPKQGVP  360
RTPAKATEET SIGAEARKTK TSAAAEENGW APELQLSLSP NAAADTVEKG KKRNSAGQEV  420
SSDKVPLSLS LSLHGGVVDD DDGGGRDGRR LEVATGSSSK KAALGLSTLD LTMSIKALE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0736061e-105AK073606.1 Oryza sativa Japonica Group cDNA clone:J033048N17, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010227658.11e-169PREDICTED: uncharacterized protein LOC100830272
TrEMBLM8C1H00.0M8C1H0_AEGTA; Putative Myb family transcription factor
STRINGMLOC_49594.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40260.12e-33G2-like family protein