PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27986
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 573aa    MW: 63477.2 Da    PI: 6.8336
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27986genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.41.6e-33250304155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               k+r+rWtpeLHe+Fv+ v++LGGsekAtPk +l+lmkv+gLt++hvkSHLQkYR+
  EMT27986 250 KQRMRWTPELHECFVDSVNKLGGSEKATPKGVLKLMKVDGLTIYHVKSHLQKYRT 304
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.796247307IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.4E-31248306IPR009057Homeodomain-like
SuperFamilySSF466895.55E-17249304IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-25250304IPR006447Myb domain, plants
PfamPF002491.6E-8252303IPR001005SANT/Myb domain
PfamPF000782.8E-8346410IPR000477Reverse transcriptase domain
PfamPF143793.0E-24436482IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MEHIKINLWE RRNACPQFLM RRCDLRQSHN SRVSGGMSSS LPILPNSLKE TFHGPYNPQL  60
TPMQRQLTSD LVPLHQSALP SATLHPRAGA MRSSYAASLG YSPNPLDSAP NHERQSMVAP  120
FAPQPSDIEV FQTLSNNIPG GHTGATWFPG SADGLSDYGD NIPASGSQIQ NGGPAVTSDV  180
VAKQNEWWAE IMNDDWRDIL DATAADPQSK SMVQPSNSAA SQPAVNQPAS SHGGEICNVA  240
SPPNSNSAAK QRMRWTPELH ECFVDSVNKL GGSEKATPKG VLKLMKVDGL TIYHVKSHLQ  300
KYRTARYKPD LMEGTAEKRT TTEELTLDLK SKTFKELTCP PTNVMWRALE KHKAPTKYIT  360
LIKDMYDNVV TSVRTSDGDT DDFPSKIGLQ QGSALSPYLF ALVTDECLNK RLGTFRKYLA  420
VWKDITCFPE LMSRSMDLTE ALRLQMEVQK RLHEQLETQR KLQLRIEEQG KYLQMMFEKQ  480
SKSNTEKVQD LSSGATTTLS SEPSHPATRN RDNDAADDVN RTGENPVSAE IGETLMHAGG  540
NQEMAESESS DPLANTNDGS KAPQEKRRRV HDS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-29249308160Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1565569KRRRV
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling. Binds to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes. Functionally redundant with PHR2 and PHR3 in regulating Pi starvation response and Pi homeostasis. {ECO:0000250|UniProtKB:Q10LZ1}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3575970.0AK357597.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv1057F14.
GenBankAK3583140.0AK358314.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1073J04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020173453.10.0protein PHOSPHATE STARVATION RESPONSE 1-like isoform X1
SwissprotB8ANX91e-123PHR1_ORYSI; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLM8CVX60.0M8CVX6_AEGTA; Myb family transcription factor APL
STRINGEMT279860.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19713789
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.17e-40phosphate starvation response 1