PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27961
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 225aa    MW: 24979.2 Da    PI: 8.582
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27961genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM170.93.9e-53161451129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk..kgel 99 
               lppG+rFhPtdee+++ yL++k+ +  +++ ++i evd++k ePw+Lpkk+k +e+ewyf++++d+ky+tg r+n+atk+gyWk+tgkdke+++   ++ l
  EMT27961  16 LPPGYRFHPTDEEIITSYLAPKILNPAFDA-TAIGEVDVNKNEPWELPKKAKMGENEWYFYCQKDRKYPTGIRTNQATKAGYWKTTGKDKEIVNPhcTSML 115
               79***************************9.88***************99999*****************************************9878888 PP

       NAM 100 vglkktLvfykgrapkgektdWvmheyrle 129
               +g+kktLvfykgrap+gekt+Wvmheyrle
  EMT27961 116 IGMKKTLVFYKGRAPSGEKTNWVMHEYRLE 145
               ****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-5910180IPR003441NAC domain
PROSITE profilePS5100555.8416179IPR003441NAC domain
PfamPF023655.6E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MADHLQVQQQ QQQLELPPGY RFHPTDEEII TSYLAPKILN PAFDATAIGE VDVNKNEPWE  60
LPKKAKMGEN EWYFYCQKDR KYPTGIRTNQ ATKAGYWKTT GKDKEIVNPH CTSMLIGMKK  120
TLVFYKGRAP SGEKTNWVMH EYRLEIGKQS TTGLPTAITN AASINASSKE YVVCRIFHKN  180
TGSGLSSMVS HEDVGTRPGN NDQGNGSGTT THKISSMSMG TDGAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A7e-4941833169NO APICAL MERISTEM PROTEIN
1ut4_B7e-4941833169NO APICAL MERISTEM PROTEIN
1ut7_A7e-4941833169NO APICAL MERISTEM PROTEIN
1ut7_B7e-4941833169NO APICAL MERISTEM PROTEIN
4dul_A7e-4941833169NAC domain-containing protein 19
4dul_B7e-4941833169NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197640.0FR819764.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC019 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020191194.11e-171NAC domain-containing protein 100-like
SwissprotQ9FLJ24e-77NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A453DZZ61e-170A0A453DZZ6_AEGTS; Uncharacterized protein
STRINGEMT279611e-171(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP145237121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.12e-75Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]