PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27812
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 508aa    MW: 55218.8 Da    PI: 9.9423
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27812genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.8e-31106159255
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               prlrWtp+LH +F++ave+LGG+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  EMT27812 106 PRLRWTPDLHMAFIRAVERLGGQERATPKLVLQMMNVRGLSIAHVKSHLQMYRS 159
               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.702102162IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.9E-28102160IPR009057Homeodomain-like
SuperFamilySSF466899.32E-14105160IPR009057Homeodomain-like
TIGRFAMsTIGR015574.4E-22106161IPR006447Myb domain, plants
PfamPF002495.5E-9107158IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MITREEERII GDVEDKQVLA KITMDDRKRS MSGSMLDLNE GIHMESDDGE VGDDNDEEEE  60
DGGSTTDVAG SRSSSNNSST NHALETQQGT GGGEHRVRQY NRSKLPRLRW TPDLHMAFIR  120
AVERLGGQER ATPKLVLQMM NVRGLSIAHV KSHLQMYRSK KLDHHGQRIR GAISSGSHQS  180
QKFRSNSPKT LVLMRGYSSS TCGHVASAVF SPMDFHSMRG DRRFHDMLLQ RAAALSSTAE  240
RGGFFVSRNG GGGGGNTNSR LYGILQHHHL PSPMQSGFKN GSFRNQEWAF DHRNMMARND  300
VKASSATPHF FASSSVRRWP LISAVAGAGE QMRDESFGYF TGHGSGPLSR AMAPATSVVP  360
GGGSHRLPFR WHGGDGGKGA KATSSDPVMI VEALDSQKQK HLEQQRALIT AADKARLPAE  420
TPELELSLSP ATAIDATDGT PSKKRKKSAA ASREQELEHA NKLSISLSLM PPAASMPMQG  480
QEKIRGGSVE AALGQSTLDL TMSIKALE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-18107159456Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1442446KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020187256.10.0uncharacterized protein LOC109772958 isoform X1
TrEMBLM8CKE40.0M8CKE4_AEGTA; Putative Myb family transcription factor
STRINGEMT278120.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP27543686
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.13e-36G2-like family protein