PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27095
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family LFY
Protein Properties Length: 143aa    MW: 15955.3 Da    PI: 9.5126
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27095genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY239.22e-7321128278385
   FLO_LFY 278 PtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLC 378
               P  vtnqvfrya k+gasyinkPkmrhYvhCYalhcLde+as+alrra+k+rgenvGawrqacy+plv+iaar+g+didavf+ahprL+iWYvPt+LrqLC
  EMT27095  21 PCHVTNQVFRYASKVGASYINKPKMRHYVHCYALHCLDEDASDALRRAYKARGENVGAWRQACYAPLVDIAARHGFDIDAVFAAHPRLAIWYVPTRLRQLC 121
               999************************************************************************************************** PP

   FLO_LFY 379 hlerska 385
               h++rs++
  EMT27095 122 HQARSAH 128
               ****987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.7E-7421128IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MTWRQRQGEG PSLGCRVAGL PCHVTNQVFR YASKVGASYI NKPKMRHYVH CYALHCLDED  60
ASDALRRAYK ARGENVGAWR QACYAPLVDI AARHGFDIDA VFAAHPRLAI WYVPTRLRQL  120
CHQARSAHDA AAAHAGAMPP PMF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A3e-622112656161PROTEIN LEAFY
2vy2_A3e-622112656161PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2318880.0AB231888.1 Triticum aestivum WFLa mRNA for FLORICAULA/LEAFY-like protein, complete cds.
GenBankAB2318900.0AB231890.1 Triticum aestivum WFLd mRNA for FLORICAULA/LFAFY-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020152169.12e-83probable transcription factor FL
SwissprotA2XX393e-71FL_ORYSI; Probable transcription factor FL
TrEMBLM8BQ001e-101M8BQ00_AEGTA; Putative transcription factor FL
STRINGEMT270951e-102(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP82693649
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-60floral meristem identity control protein LEAFY (LFY)