PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT27093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family M-type_MADS
Protein Properties Length: 389aa    MW: 43199.6 Da    PI: 6.5546
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT27093genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF66.72.2e-211053245
              ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
    SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
              + en+s rqvt+skRr gilKKA+ELS+LCd++  +++fs++g+
  EMT27093 10 KLENTSGRQVTYSKRRSGILKKAKELSILCDIDLILLMFSPSGR 53
              679**************************************995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006624.558153IPR002100Transcription factor, MADS-box
SMARTSM004321.1E-28160IPR002100Transcription factor, MADS-box
SuperFamilySSF554559.68E-25295IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-17323IPR002100Transcription factor, MADS-box
PfamPF003198.8E-191154IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004043.3E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 389 aa     Download sequence    Send to blast
MGRVKLKIKK LENTSGRQVT YSKRRSGILK KAKELSILCD IDLILLMFSP SGRPTICVGD  60
KSPIDEVIAK YAQQTPQERA KRKLESLEAL KKTFKKLDHD VNIQDFLGSG GQTVEELSSH  120
LGALQCQMAD VQKRLSYWSD PEKVENIDHI RAMEQSLKES LNRIGIHKEN FAKQHLMGLQ  180
CAAAQFQNEM QLPLGLTGDP NPSSWFHSGG GSDGQPPMML PEDPSLLHQR DIGCSTSTSL  240
QSYPGYFSMS KQSTDTAGGE QQHQQAAAVH QHQHQHQQPE FSQGDCLTSL HLGAQFPYQS  300
AFDHASLLND RLFRPDMELH VDNAAASAMD FVGGHYEMPR PGDEASFQNW ASAACGATMY  360
DHQQQPPSAQ LIVQNMTESL TVSSLQQQL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A6e-13192190MEF2 CHIMERA
6byy_B6e-13192190MEF2 CHIMERA
6byy_C6e-13192190MEF2 CHIMERA
6byy_D6e-13192190MEF2 CHIMERA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3731110.0AK373111.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3021H04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020192405.10.0agamous-like MADS-box protein AGL65
TrEMBLA0A3B6JH600.0A0A3B6JH60_WHEAT; Uncharacterized protein
TrEMBLA0A453HVK80.0A0A453HVK8_AEGTS; Uncharacterized protein
TrEMBLM8BZ660.0M8BZ66_AEGTA; MADS-box transcription factor 2
STRINGEMT270930.0(Aegilops tauschii)
STRINGTraes_4DS_4C4EB1D21.20.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46263659
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18750.14e-74AGAMOUS-like 65