PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25175
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 648aa    MW: 72046.6 Da    PI: 6.1318
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25175genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.71.2e-1072706421374
      GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqa 101
               l++lL++cA+av+++d + a++lL++++ +a pdgd +qRla++f+e+L+ar+a+++  + ++l +++ s    ++ l+a++l+  +  + k+s+l  N++
  EMT25175 270 LRTLLIHCAQAVATDDRRSATELLKQIKLHARPDGDGTQRLAHCFAEGLQARMAGTGGLVHQSLMATRIS---AVDMLKAYQLYMAAICFKKVSFLFSNST 367
               6789***************************************************888888777777776...9*************************** PP

      GRAS 102 IleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgE 200
               I++a  g++++HiiD++i++G+QWp++l+ +++Rp+gpp +RiTg++ p++g   +e++eetg+rL+k+A+e++vpfe++++++ ++e+l+ e+L+++p+E
  EMT25175 368 IYNASLGKKKIHIIDYGIQYGFQWPCFLRRISTRPGGPPDVRITGIDLPQPGfrPTERIEETGRRLKKYAHEFNVPFEYRAIATAKMESLRKEDLKIDPDE 468
               ***************************************************9*****************************9999**************** PP

      GRAS 201 alaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvace 301
               +l+Vn+ +q ++l+desv les+rd vLk +++++P+ ++++  + + +++ F++rf e l yysalfd l+++ pr++e+r+ +E+ +lgr++ nv+ace
  EMT25175 469 VLIVNSLFQFKNLMDESVVLESPRDVVLKNIRKMQPHTFIHAIVNGSFSAPFFVTRFREVLFYYSALFDVLDTTTPRDNEQRMLIEQNILGRAALNVIACE 569
               ***************************************************************************************************** PP

      GRAS 302 gaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
               g++r+er et+++W+ r ++aG+k +pl+ ++ + a+  +++++ + + ++ ++++l++gWk+r L+++S W+
  EMT25175 570 GTDRVERPETYKQWQVRNQRAGLKLLPLNPEVIELARDKVKNCYHKDFVIDIDQHWLLQGWKGRILYAISTWT 642
               ********************************************889*************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098562.32244622IPR005202Transcription factor GRAS
PfamPF035144.1E-105270642IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 648 aa     Download sequence    Send to blast
MEEDIDDKFF YDFPDNPALI EAQQPFLEIL SDPSSNSTSD DSNNRAVSPC SPSDASVGNA  60
AQLPPTPAAV DSYDRFQFEP VDLDPAAFFG GGANSDLMSS AFLKGMQEAN KFLPSQDKLV  120
IDLEASSGQF FKGVEEGNKF LPREDKLVAG FNGHAAPAPA PAVLSVKKEE AVDAVSANSG  180
GGRGRKNPYH DDELEQEGGR SSKQSALGDD VSAREMFDRM LMPSDEMCIV QMQNLRIAMQ  240
EAVAKNDSGG GKGANGKGRG RRGGSDVVDL RTLLIHCAQA VATDDRRSAT ELLKQIKLHA  300
RPDGDGTQRL AHCFAEGLQA RMAGTGGLVH QSLMATRISA VDMLKAYQLY MAAICFKKVS  360
FLFSNSTIYN ASLGKKKIHI IDYGIQYGFQ WPCFLRRIST RPGGPPDVRI TGIDLPQPGF  420
RPTERIEETG RRLKKYAHEF NVPFEYRAIA TAKMESLRKE DLKIDPDEVL IVNSLFQFKN  480
LMDESVVLES PRDVVLKNIR KMQPHTFIHA IVNGSFSAPF FVTRFREVLF YYSALFDVLD  540
TTTPRDNEQR MLIEQNILGR AALNVIACEG TDRVERPETY KQWQVRNQRA GLKLLPLNPE  600
VIELARDKVK NCYHKDFVID IDQHWLLQGW KGRILYAIST WTANDASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-442746418374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3579960.0AK357996.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1066L11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003579265.10.0PREDICTED: scarecrow-like protein 34
TrEMBLM8BJI90.0M8BJI9_AEGTA; Uncharacterized protein
STRINGMLOC_21297.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-161SCARECROW-like 14