PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25059
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 365aa    MW: 39145.7 Da    PI: 10.1863
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25059genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like71.41.3e-22104148246
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
               pr+rWt+ LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+h+
  EMT25059 104 PRMRWTTALHAHFVQAVQLLGGHERATPKSVLELMNVKDLTLAHM 148
               9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.38E-8101147IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.7E-19101148IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-15104147IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 365 aa     Download sequence    Send to blast
MATAADAPDL SLHISPPSPT GKAGSGRGHE MAISAESTEL CLGFDMATAR QPGEVRNGHS  60
DLEQRLHQPS QIPRFKKSSA DSQAGSSGGA ARSGNGGKKS SRAPRMRWTT ALHAHFVQAV  120
QLLGGHERAT PKSVLELMNV KDLTLAHMYR TVKGTASDRS CAAGHGQIRD MGFLRRDGEV  180
HGFDMFSNII SNTRRQPWAS PAEQLQPPFA QEQGGGGPPL PSAYLMSIHQ YLMKQNQGWR  240
GAQQQDASLN CPGQDRGQRL HVGARHDETP RIGSSTAGFA RGWSSSSSLS LSPSPSTPLQ  300
MNGRNAGSAA EQACMKQQQA PSRVPSLEMS LGRQGWQNAI EQQQRQGQPS VESSASKELT  360
LLKCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014754878.11e-148PREDICTED: uncharacterized protein LOC100834660
TrEMBLM8BSW90.0M8BSW9_AEGTA; Putative Myb family transcription factor
STRINGMLOC_10064.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.26e-27G2-like family protein