PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23891
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 356aa    MW: 39019.3 Da    PI: 5.1699
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23891genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like50.93.3e-161862152655
   G2-like  26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               +AtPk il+lm+ +gLt++h+kSHLQkYR+
  EMT23891 186 RATPKGILKLMNSDGLTIYHIKSHLQKYRM 215
               8****************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-14183216IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-11186216IPR006447Myb domain, plants
SuperFamilySSF466894.3E-6186215IPR009057Homeodomain-like
PfamPF143792.3E-22252298IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MARGVNTPTS KNQAKKIRLH DRYCDGMMPL CNPSSEARQL SASSTGLPTS HQELFMSAGF  60
QQQQQAQDRA GAAAGQPWMD RQALLMVTDV PSEISEGPVD GGAEQQQQPA EPDGEPPVRP  120
PHVSPVDGGA EQQQQPAEPD GEPPVRQEQR RRASDLHRHR QRVSASAEQD ADPVDAGAAR  180
AVRGLRATPK GILKLMNSDG LTIYHIKSHL QKYRMAKYMP APSSSSSSEG RQHEKRAAGS  240
DTQHELDPKT GMHITEALRV QLDVQRRLHE QLEIQRKLQV RIEEQGKRLQ KMFEDQLKAS  300
GNTAPAAGPD VVLFPAAAET PSEQEEDTVF VDVIDDDDEV QIISVASGSY DDDLAL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3643321e-164AK364332.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2023N07.
GenBankAK3709621e-164AK370962.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2121B01.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020165250.16e-98uncharacterized protein LOC109750710 isoform X1
RefseqXP_020165251.15e-98uncharacterized protein LOC109750710 isoform X2
TrEMBLM8CKH80.0M8CKH8_AEGTA; Myb family transcription factor APL
STRINGEMT238910.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP69333751
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.12e-37G2-like family protein