PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT23566
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family B3
Protein Properties Length: 272aa    MW: 29709.6 Da    PI: 8.0637
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT23566genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B353.34.9e-17261101499
               T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
        B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                 lvlp kf++  +g + ++++l++e    r W+v++ ++ +++++ l++GWkeFv+ang++ g  +vF +dg   + l+vkvf+ 
  EMT23566  26 EKLVLPDKFVRGLNGRELRGVKLRVEGGGARAWDVEVVVNECGDMH-LGRGWKEFVRANGVELGQLLVFCYDGAGAALLTVKVFDD 110
               569**********9999**********999*******777777666.999***********************99999*****985 PP

2B344.52.8e-141732601195
               HHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTE.....EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEE CS
        B3  11 lksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgr.....yvltkGWkeFvkangLkegDfvvFkldgr.sefelvvk 95 
                k++ l +p +f ++hg  +++   ++    +g++W+v l++  r  +++     + l+ GW++F  +ngL++gD++ F+l+++  +  +v++
  EMT23566 173 KKKQYLNVPVEFSQSHGFTEKGR--VV-LRMRGQQWTVCLKHsnR--RKGnartrTALRYGWNRFRVDNGLRVGDICFFQLVQDaGGDDPVLS 260
               5677899*********8876553..44.45699*****9988652..333346779*************************998777767665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.7613111IPR003340B3 DNA binding domain
SuperFamilySSF1019364.12E-1514113IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.8E-415111IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.9E-1515112IPR015300DNA-binding pseudobarrel domain
PfamPF023621.4E-1424109IPR003340B3 DNA binding domain
CDDcd100171.00E-1427109No hitNo description
Gene3DG3DSA:2.40.330.106.3E-21159267IPR015300DNA-binding pseudobarrel domain
CDDcd100175.34E-13160265No hitNo description
SuperFamilySSF1019365.89E-15160251IPR015300DNA-binding pseudobarrel domain
SMARTSM010192.4E-5161267IPR003340B3 DNA binding domain
PROSITE profilePS5086312.083163267IPR003340B3 DNA binding domain
PfamPF023621.1E-11173259IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MAQGQGSPDL VGFQFYKLMA AGMSWEKLVL PDKFVRGLNG RELRGVKLRV EGGGARAWDV  60
EVVVNECGDM HLGRGWKEFV RANGVELGQL LVFCYDGAGA ALLTVKVFDD SECGRHCSQR  120
EEENDSVEEE EPPPPALPGS GSSSSDGVVH GGGGGAAPSR FTVTLGQCHL GTKKKQYLNV  180
PVEFSQSHGF TEKGRVVLRM RGQQWTVCLK HSNRRKGNAR TRTALRYGWN RFRVDNGLRV  240
GDICFFQLVQ DAGGDDPVLS VEVRKADGTI VQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-146HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020172157.10.0B3 domain-containing protein Os03g0212300-like
TrEMBLM8CJN10.0M8CJN1_AEGTA; B3 domain-containing protein
STRINGEMT235660.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47483264
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.13e-07B3 family protein