PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT22828
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 402aa    MW: 43148.8 Da    PI: 6.0588
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT22828genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.13.5e-32230285156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               kpr++W+peLH+rF++a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  EMT22828 230 KPRRCWAPELHRRFLQALQQLGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 285
               79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.822227287IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.1E-28228288IPR009057Homeodomain-like
SuperFamilySSF466897.17E-17228287IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-27230285IPR006447Myb domain, plants
PfamPF002491.8E-6232283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 402 aa     Download sequence    Send to blast
MEMEMEVPPA QADCDGARRR LQDYLLALEE ERRKIHVFQR ELPLCLDLVT QTIEGMKSQM  60
GGAASEETVS DHGGPVLEEF IPLKPSLSLS SSDDETSNHH AAAPVSNAKA ETPPPTPETK  120
KAMPDWLQSA QLSTWSEPQQ SSSLQKVLPC RPVALNATRT GGAFHPFEKE KQPEPELPAS  180
STTAPASSAL VGDSGDKATS DTEVHDKDSK DVTEKDTDKD KEGHSQPNRK PRRCWAPELH  240
RRFLQALQQL GGSHVATPKQ IRELMKVDGL TNDEVKSHLQ KYRLHTSRRP SSTAQSGATA  300
ATQPAPQFFV VGSCIWVPQQ EYAAAAAAAA AAADATNVAP GSANQVYART ATLPSGLKPH  360
LEKQSSRQSE GPRSGDTGGV NSDTDNPAMS SSSSQTTSAG HP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-13230283255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that may play a role in response to nitrogen. May be involved in a time-dependent signaling for transcriptional regulation of nitrate-responsive genes. Binds specifically to the DNA sequence motif 5'-GAATC-3' or 5'-GAATATTC-3'. Represses the activity of its own promoter trough binding to these motifs.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by nitrate. {ECO:0000269|PubMed:23324170}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3616380.0AK361638.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1145I13.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020198678.10.0myb family transcription factor EFM-like
RefseqXP_020198679.10.0myb family transcription factor EFM-like
SwissprotQ6Z8691e-128NIGT1_ORYSJ; Transcription factor NIGT1
TrEMBLA0A453AR000.0A0A453AR00_AEGTS; Uncharacterized protein
TrEMBLM8BLZ20.0M8BLZ2_AEGTA; Two-component response regulator ARR2
STRINGEMT228280.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64703754
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-59G2-like family protein
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Sawaki N, et al.
    A nitrate-inducible GARP family gene encodes an auto-repressible transcriptional repressor in rice.
    Plant Cell Physiol., 2013. 54(4): p. 506-17
    [PMID:23324170]