PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT21538
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 245aa    MW: 27043 Da    PI: 6.8462
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT21538genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.81.4e-291871255
   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              pr+rWt+eLH++F+eav+ LGG+++AtPk+il+lm+ kg++++h+kSHLQ+YR+
  EMT21538 18 PRMRWTEELHRQFIEAVDCLGGQDEATPKRILQLMGTKGVSISHIKSHLQMYRS 71
              9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.3E-271472IPR009057Homeodomain-like
PROSITE profilePS5129412.9531474IPR017930Myb domain
SuperFamilySSF466893.05E-161672IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-241871IPR006447Myb domain, plants
PfamPF002491.6E-81970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MRGFERRGVR QYNRSDEPRM RWTEELHRQF IEAVDCLGGQ DEATPKRILQ LMGTKGVSIS  60
HIKSHLQMYR SSSSGSGSSN PPHASVNRCQ DHCVDGHITA TSASDRIDIP SYAVFGRGHH  120
SMLPPCQLPS IEEVFRSWEQ SRGRLQWNSS GMLNTPEKAT GWSHHANGKM CQKQQRAAVG  180
CDLTLSVGRW EEEVASSDTD ISSTTTEEAV VPARGQGASG QRPPEASADL NLDLNLDLAI  240
SSSWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-161972356Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519404e-94JF951940.1 Aegilops speltoides clone TaMYB57 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020178887.10.0probable transcription factor KAN4 isoform X1
TrEMBLM8BIF20.0M8BIF2_AEGTA; Putative Myb family transcription factor
STRINGEMT215380.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.13e-24G2-like family protein