PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20949
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 250aa    MW: 27661.6 Da    PI: 7.8715
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20949genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like94.86.8e-301871255
   G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              pr+rWt+eLH++F+eav+ LGG+++AtPk+il+lm+ kg++++hvkSHLQ+YR+
  EMT20949 18 PRMRWTEELHRQFIEAVDCLGGQDEATPKRILQLMGAKGVSISHVKSHLQMYRS 71
              8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-281474IPR009057Homeodomain-like
PROSITE profilePS5129411.5011474IPR017930Myb domain
SuperFamilySSF466891.7E-161674IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-231871IPR006447Myb domain, plants
PfamPF002491.8E-81970IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MRGFERRGVR QYNRSDDPRM RWTEELHRQF IEAVDCLGGQ DEATPKRILQ LMGAKGVSIS  60
HVKSHLQMYR SSFSNTNSNG GPPNASVDRC RGHRAVDTSW NGHGNDMAAA SDRIDASSCT  120
VPPRGCRSSP PYQIPMIEGV FRSWEQSRGR LPWNSIMPSE KATGSARHAD SRTHQKNRQP  180
TPGCDLTLSI GRCEEEAMVA SSDTDVSSMT TEESAAVPAR DRGADYHRRS DTAGLNLDLN  240
LDLAVSSSWL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-171972356Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3716052e-83AK371605.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2138C08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020187651.10.0two-component response regulator ARR11-like
TrEMBLA0A453SYM00.0A0A453SYM0_AEGTS; Uncharacterized protein
TrEMBLM8BG540.0M8BG54_AEGTA; Putative Myb family transcription factor
STRINGEMT209490.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54933758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.12e-25G2-like family protein