PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT20592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family CPP
Protein Properties Length: 803aa    MW: 87168.5 Da    PI: 6.9717
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT20592genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.6e-16479517240
       TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
               ++k+C+CkkskClk+YCeCfaag++Cse C+C++C Nk 
  EMT20592 479 SCKRCSCKKSKCLKLYCECFAAGVYCSEPCSCQGCLNKP 517
               689**********************************96 PP

2TCR49.21e-15564603140
       TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
               ++k+gCnCkks+ClkkYCeC++ g+ Cs++C+Ce CkN+ 
  EMT20592 564 RHKRGCNCKKSSCLKKYCECYQGGVGCSNNCRCETCKNTF 603
               589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.6E-17478519IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.145479604IPR005172CRC domain
PfamPF036389.1E-12481516IPR005172CRC domain
SMARTSM011141.6E-15564605IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.5E-11566602IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MGSEFSTTQQ YMPLTVTVQD SPLFSFINSL SPIEPLKSAY SGNGLQAYHQ SLNVTSVSSI  60
FTSPHHNAHK ESKLSKSSFA DYTENELCME DGTDKNKSPT SSTAVRLFAC TSTITRESHT  120
MITCSVNEGI VDPPKGPNDF PQPGRFDSGS PDHNTAPCHG VSVRSDLKQD KCPKLETVQT  180
TNNTVEKRKC LFSSDMQLQD GCQPAKENNE VMGCEWEDLV SVTSGELLAF DSSMDQHHTG  240
VQLAVNNAES CGYLLSKLAG GADISDRTHP ATSSQAYYHE MVVGEDKTEN GQLFPEDKKT  300
ILSEEIQDNI NEENACIPLG CKVETQQRGV RRRCLVFEAA GYSHRTVQKE SVGDLSFSTC  360
KGKSSAQNHR NPGKTPSPHV FRGIGLHLNA LALTSKDKMA CQDPLATALV PSLKTEQDVH  420
GNLLSAGGNF VHSGSGLLDL QMDNDDCSVG GFLGNDHNSS QSSSPPKKRR KSDNGDDDSC  480
KRCSCKKSKC LKLYCECFAA GVYCSEPCSC QGCLNKPIHE EIVLSTRKQI EFRNPLAFAP  540
KVIRMSEAGQ ETQEDPKNTP ASARHKRGCN CKKSSCLKKY CECYQGGVGC SNNCRCETCK  600
NTFGTRDVAV SAENEEMKQE GDQTESCEKE KENDQQKANV HSEDHKLVEL VVPITPPLDV  660
SSSLLKQPNF SNAKPPRPCK ARSGSSSRSS KASETVQSRK ISKVGDSVFI EEMPDILREP  720
SSPGIVKTCS PNGKRVSPPH NALSISPNRK GGRKLILKSI PSFPSLAGDT NGGSAICSSD  780
SATALALGQA YSLCRHDMSF VFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1548160112120Protein lin-54 homolog
5fd3_B1e-1548160112120Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1465471PKKRRKS
2466470KKRRK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3750970.0AK375097.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3085F14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167196.10.0protein tesmin/TSO1-like CXC 3
TrEMBLR7WCV20.0R7WCV2_AEGTA; Uncharacterized protein
STRINGEMT205920.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61473447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.12e-91TESMIN/TSO1-like CXC 2