PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT19910
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ERF
Protein Properties Length: 231aa    MW: 24823 Da    PI: 4.6706
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT19910genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP255.71.2e-1747100156
       AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 
               + y+GVr++ + grWv+e+r+p ++g   r +lg++  ae Aa+a++aa+++l g+
  EMT19910  47 PVYRGVRRRGSAGRWVCEVRVPGKRG--ERLWLGTYAAAESAARAHDAAMLALLGH 100
               68*******************95544..************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008474.3E-1347100IPR001471AP2/ERF domain
PROSITE profilePS5103220.75848111IPR001471AP2/ERF domain
SMARTSM003803.9E-1748113IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.104.3E-2648113IPR001471AP2/ERF domain
SuperFamilySSF541712.94E-1648113IPR016177DNA-binding domain
CDDcd000181.29E-1349113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MDTAIDSWIS SPSSSTSGHE HGEVVPVWSP AAKRPAGRTK FKETRHPVYR GVRRRGSAGR  60
WVCEVRVPGK RGERLWLGTY AAAESAARAH DAAMLALLGH SASAAACLNF PDSAWLLVMP  120
PWLSDLADIR RAAIEAVAVF LCLEAAAVVP VVDEATSPVY LLSPVDNADE VFQLPTFSAQ  180
GSDMFELDMS GEMDLDPYYA GFAQGMLLEP PPTPAYWENG DGGAAAGLWS Y
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription. Confers resistance to high salt, cold and drought stress (By similarity). {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7584940.0JF758494.1 Triticum aestivum clone 1179D19 genomic sequence.
GenBankJN9872060.0JN987206.1 Triticum aestivum AP2 domain CBF protein (CBFIIId) mRNA, CBFIIId-24.1 allele, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167754.11e-168dehydration-responsive element-binding protein 1H-like
SwissprotA2Z3893e-56DRE1A_ORYSI; Dehydration-responsive element-binding protein 1A
TrEMBLF5CPS61e-166F5CPS6_WHEAT; AP2 domain CBF protein
TrEMBLN1R1L11e-166N1R1L1_AEGTA; Dehydration-responsive element-binding protein 1A
STRINGEMT199101e-167(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25470.13e-24C-repeat/DRE binding factor 2