PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT19786
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 337aa    MW: 36518.1 Da    PI: 8.0041
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT19786genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like70.52.6e-2297141246
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehv 46 
               pr+rWt+ LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+h+
  EMT19786  97 PRMRWTTALHAHFVRAVELLGGHERATPKSVLELMNVKDLTLAHM 141
               9*****************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.52E-894140IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.3E-1994141IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-1497140IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MSTPPPPLPE ACSITMAVAP DLSLHISPPS PDTAVGHNGE VRLGLHESAA KRHRGLEEML  60
HQPNKAHGFK KSSCPDVGGG AVARPAAGGR KRSSRAPRMR WTTALHAHFV RAVELLGGHE  120
RATPKSVLEL MNVKDLTLAH MYRTVKGTDR SCVAGHGQTR DMGFLRRVVA GDELINGFDG  180
FNSNMVNTTS NYTTPRRSES PAGEQGHHDA WRTQAAAAAA TTTIMVPPYL TTSEPHDNEH  240
IMPENGMARP AAPRRGRPSP NNTSSSGSDD VDETESFGWL ALTRRRYDED CAGDRVLQDA  300
AMVMAPSLEM RLGRQGWEQM EPSASASKEL TPIVRCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3640540.0AK364054.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2021D04.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020183178.10.0probable transcription factor KAN4
TrEMBLR7WBK20.0R7WBK2_AEGTA; Putative Myb family transcription factor
STRINGEMT197860.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37423168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.21e-28G2-like family protein