PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18588
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 646aa    MW: 72184.5 Da    PI: 6.9775
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18588genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS3335.5e-1022636352373
      GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaI 102
               ++lL++cAeav+++d ++a  lL+++++++ p+gd+ qRla yf+e+L+arla+++ ++y+++++ + +  +++e +++++l   ++ +lk+s    N+ I
  EMT18588 263 ETLLIRCAEAVATNDRSNAGDLLKKIKQHSLPTGDARQRLAYYFAEGLEARLAGTGRQMYHSITMANHT--STVELFKSYHLCIAACCFLKVSLNFSNKNI 361
               789**********************************************************99888887..599999************************ PP

      GRAS 103 leavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEa 201
               ++av+g +++Hi+ ++++ G+QWp Ll+ La+R++gpp++RiTg+ sp++g   +++ +et++rL+  A+++gvpf+f++ +  +le+++ e+L+++p+E+
  EMT18588 362 YNAVAGRKKLHIVHYGVNDGFQWPDLLRWLADREGGPPEVRITGIISPQPGpcPAKQAKETKRRLSYCARQFGVPFKFHA-IIAKLEAVHAEDLDIDPDEV 461
               ****************************************************99**************************.6999**************** PP

      GRAS 202 laVnlvlqlhrlldesvs..leserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvac 300
               l+Vn +++  +l+des++  +e++rd vL+++k+++P +++++  +  ++s+ F++rf +al+ ++a fd++e+++ +++e+r  vEr++++r+++n++ac
  EMT18588 462 LVVNNMFHFRTLMDESLTfdMENPRDLVLNTIKKMKPSMLIHAAVNGAYSSAFFMTRFRQALNNFTAQFDMMETTMMQNKEKRLLVERHIFARSVMNIIAC 562
               ***************98622677****************************************************************************** PP

      GRAS 301 egaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               eg +r+er +++++W++r ++aG+++++l+ +++k  k  ++k + + ++++e++ +l+lgWk+r L+++S W
  EMT18588 563 EGPDRVERPQNYKEWHARNQRAGLRQLSLDPDIVKMLKDQVKKQYHKHFMIDEDQRWLLLGWKGRVLYALSTW 635
               *********************************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.358236616IPR005202Transcription factor GRAS
PfamPF035141.9E-99263635IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MPAMAAAQEE PLGLVKPAPP PPPPSIFLDQ PSMTNGDSQS QQPQDDLALA YISRMLMEED  60
IIDKFFYQHP EHPTLLQAEQ PFAEILSASG ITTAGAHGSS ALLPSQGNNT GIMASGFLSS  120
EVRSQALILN GTVTAEEPSS GVTMGDLSSM AFFKGMEEAN SFLPTVNVMV DARARKKRSG  180
MDGETEACMG RSSKQIAVRV LAHDDSAEED TALELDLLIL NGYNMHSNET MKERGDQAAH  240
QSICRKAPCV RHSARQKVVA DLETLLIRCA EAVATNDRSN AGDLLKKIKQ HSLPTGDARQ  300
RLAYYFAEGL EARLAGTGRQ MYHSITMANH TSTVELFKSY HLCIAACCFL KVSLNFSNKN  360
IYNAVAGRKK LHIVHYGVND GFQWPDLLRW LADREGGPPE VRITGIISPQ PGPCPAKQAK  420
ETKRRLSYCA RQFGVPFKFH AIIAKLEAVH AEDLDIDPDE VLVVNNMFHF RTLMDESLTF  480
DMENPRDLVL NTIKKMKPSM LIHAAVNGAY SSAFFMTRFR QALNNFTAQF DMMETTMMQN  540
KEKRLLVERH IFARSVMNII ACEGPDRVER PQNYKEWHAR NQRAGLRQLS LDPDIVKMLK  600
DQVKKQYHKH FMIDEDQRWL LLGWKGRVLY ALSTWVADDA SGSQLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-432666358374GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1284289LKKIKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575624.30.0PREDICTED: scarecrow-like protein 33
TrEMBLR7WAD80.0R7WAD8_AEGTA; Uncharacterized protein
STRINGBRADI4G09235.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.11e-124GRAS family protein