PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18587
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family GRAS
Protein Properties Length: 531aa    MW: 60482.2 Da    PI: 7.4641
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18587genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS311.81.6e-9516252015373
      GRAS  15 gdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaNqaIleavegeervHii 115
               ++ e+ ++++ +  ++++ ++ ++qRla+yf+e+L+arla+ +s+ly+al +++t+   ++e+l+a+klf  ++ ++k+++l  N++I++av g +++Hi+
  EMT18587 162 EESEMLDQFMLNSYDMCTTEAHATQRLAHYFAEGLEARLAGRGSQLYRALMVKRTP---VVEVLKAYKLFMSACCFMKVCFLFSNKTIYNAVMGRHKLHIV 259
               55667777888888899999***********************************9...****************************************** PP

      GRAS 116 DfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrll 214
                ++++ G+QWp Ll+ La+R++gpp++RiT + s ++g   +e+++ tg+rL++ A+++gvpfef+v +a + ed+++e+L+++p+E+l+Vn+ ++  +l+
  EMT18587 260 HYGVNDGFQWPDLLRWLAEREGGPPKVRITSITSLRPGfrPAEQTHDTGQRLRRCAKQFGVPFEFRV-IAAKAEDVRVEDLNINPDEVLVVNSLIHFRSLM 359
               **********************************999999**************************9.7999***************************** PP

      GRAS 215 desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetle 313
               desv ++   +rd vL+++++++P v+v++  +a++n++ F++rf + l+ ++a fd++ea++pr+++er  vEr +++r ++n++aceg++r+er ++++
  EMT18587 360 DESVVIDRlnPRDMVLNTIRKMKPAVFVHAIVNASYNTTFFVTRFRQVLHNFAAHFDMMEATVPRDNDERLLVERDIIARCAMNIIACEGTDRVERPQNYR 460
               ****9998889****************************************************************************************** PP

      GRAS 314 kWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaW 373
               +W++r ++aG+++++l+ ++++  k +++k + + ++++e++++l++gWk+r L ++S W
  EMT18587 461 EWQARNQRAGLRQLELDLDIVQFLKKVVKKQYHKHFMINEDHQWLLQGWKGRVLHAISTW 520
               ********************************999************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098550.408122501IPR005202Transcription factor GRAS
PfamPF035145.4E-93162520IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 531 aa     Download sequence    Send to blast
MAPTPYVFPN LQPAPALQQP HDDLALDYIS RMLMEEDIVD KFIYQYPDPA ALLQAQHPFA  60
QILTTSDTTT SSDMLTSALS SRNIQNPAFF LNGKGTAEPN NSMDVISSMA FFRGMEEANR  120
FLPRCSGAVE GSYMPHGGGG NGAEAGRSSK QMAVQVHPES KEESEMLDQF MLNSYDMCTT  180
EAHATQRLAH YFAEGLEARL AGRGSQLYRA LMVKRTPVVE VLKAYKLFMS ACCFMKVCFL  240
FSNKTIYNAV MGRHKLHIVH YGVNDGFQWP DLLRWLAERE GGPPKVRITS ITSLRPGFRP  300
AEQTHDTGQR LRRCAKQFGV PFEFRVIAAK AEDVRVEDLN INPDEVLVVN SLIHFRSLMD  360
ESVVIDRLNP RDMVLNTIRK MKPAVFVHAI VNASYNTTFF VTRFRQVLHN FAAHFDMMEA  420
TVPRDNDERL LVERDIIARC AMNIIACEGT DRVERPQNYR EWQARNQRAG LRQLELDLDI  480
VQFLKKVVKK QYHKHFMINE DHQWLLQGWK GRVLHAISTW VSDDASSTQV T
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-3917852033374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003575610.30.0PREDICTED: scarecrow-like protein 33
TrEMBLR7W8Z90.0R7W8Z9_AEGTA; Uncharacterized protein
STRINGBRADI4G09235.11e-174(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23131297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-112SCARECROW-like 14