PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT18307
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 308aa    MW: 33187.8 Da    PI: 8.3354
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT18307genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.54e-30164219156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               k+r++W+peL +rFv a+++LGG+++AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  EMT18307 164 KARRCWSPELPRRFVAALQRLGGPQVATPKQIREMMKVDGLTNDEVKSHLQKYRLH 219
               68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.822161221IPR017930Myb domain
SuperFamilySSF466891.33E-15161222IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.7E-27162222IPR009057Homeodomain-like
TIGRFAMsTIGR015574.5E-25164219IPR006447Myb domain, plants
PfamPF002494.2E-6166217IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 308 aa     Download sequence    Send to blast
MEVFRRELPI SVHLIADVIE WLKDEVAQHR RPAPDQLLAP APAPAPPAKR KAEGVKTEAD  60
ASDKRSWMSS AQLWTCGSHS STSNSNGDSI KKQAQKVSNA FMPLNGLPTL AKSSERPEAA  120
AMAVPELSLS SPAIDAPCPT APSADSSAVT DAGAQREQQS TQRKARRCWS PELPRRFVAA  180
LQRLGGPQVA TPKQIREMMK VDGLTNDEVK SHLQKYRLHT RRASDGDQQQ SASAGQWPRP  240
EQYTTSQHSS SQSGSPQGPL QLTVSSRGMS VTVGDSCDGG EENEEEDGKS ASYSWGMQQK  300
GTKASSSS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519510.0JF951951.1 Triticum aestivum clone TaMYB68 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015618787.11e-121PREDICTED: uncharacterized protein LOC4352661
TrEMBLR7W8H00.0R7W8H0_AEGTA; Two-component response regulator ARR2
STRINGBGIOSGA037689-PA1e-123(Oryza sativa Indica Group)
STRINGORGLA12G0148200.11e-123(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP55823353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-36G2-like family protein