PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT17921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ERF
Protein Properties Length: 220aa    MW: 24470.2 Da    PI: 4.7426
Description ERF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT17921genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1AP253.65.4e-1748102156
       AP2   1 sgykGVrwdkkrgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkklege 56 
               + y+GVr++ + g+Wv+e+r+p ++g + r +lg+f tae+Aa+a++ a+++l g+
  EMT17921  48 PVYRGVRRRGRVGQWVCELRVPASRG-YSRLWLGTFATAEMAARAHDSAALALSGH 102
               68*******************98887.8************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008479.7E-1348102IPR001471AP2/ERF domain
PROSITE profilePS5103220.91649109IPR001471AP2/ERF domain
Gene3DG3DSA:3.30.730.102.2E-2649111IPR001471AP2/ERF domain
SuperFamilySSF541711.7E-1649111IPR016177DNA-binding domain
SMARTSM003805.4E-1949115IPR001471AP2/ERF domain
PRINTSPR003673.2E-55061IPR001471AP2/ERF domain
CDDcd000182.23E-1662111No hitNo description
PRINTSPR003673.2E-57591IPR001471AP2/ERF domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MDTVAAWPQF EGQEYMTVWP EEQEYRTVWS EPPKRRAGRI KLQETRHPVY RGVRRRGRVG  60
QWVCELRVPA SRGYSRLWLG TFATAEMAAR AHDSAALALS GHDACLNFAD SAWRMMPVHA  120
TGSFRFAPAQ EIKDAVAVAL EAFQEQHPAD ASTTEASAPS ITSSDLSGLD DELLIDGMDA  180
GSYYASLAQG MLMEPPAAGA WREDREHDDG FDTPTSLWSY
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]CCGAC-3'. Binding to the C-repeat/DRE element mediates high salinity- and dehydration-inducible transcription. Confers resistance to high salt, cold and drought stress. {ECO:0000269|PubMed:16284406}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cold stress. {ECO:0000269|PubMed:12609047}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF7584900.0JF758490.1 Triticum aestivum clone 260E13 genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020167752.11e-161dehydration-responsive element-binding protein 1B-like
SwissprotQ3T5N42e-52DRE1B_ORYSJ; Dehydration-responsive element-binding protein 1B
TrEMBLA0A453LDF31e-160A0A453LDF3_AEGTS; Uncharacterized protein
TrEMBLF5CPR41e-160F5CPR4_WHEAT; Putative CBF2-like protein
TrEMBLR7W8231e-160R7W823_AEGTA; Dehydration-responsive element-binding protein 1B
STRINGEMT179211e-161(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP19636261
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G25480.15e-25dehydration response element B1A