PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT17282
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 232aa    MW: 26082.7 Da    PI: 10.0641
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT17282genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.46.6e-28151455
   G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              ++WtpeLH+rFveave+L G++ A+Pk+i++lm+v+gLt+e+v+SHLQkYRl
  EMT17282  1 MVWTPELHHRFVEAVEHL-GEKGAVPKAIVRLMNVDGLTRENVASHLQKYRL 51
              68****************.9*******************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015571.0E-23151IPR006447Myb domain, plants
SuperFamilySSF466893.4E-18155IPR009057Homeodomain-like
PROSITE profilePS5129414.935154IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-27155IPR009057Homeodomain-like
PfamPF002491.6E-9250IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MVWTPELHHR FVEAVEHLGE KGAVPKAIVR LMNVDGLTRE NVASHLQKYR LYLKRSSPGA  60
AAPAPPPPPF FPRFDVQRPH QDSANRSGYC AYPPSTCIRC ANLVLTNQRA PCGRVGAYPQ  120
ANDPCDSTLN SEFRTQRQTE YLLEAFHLQH RAAETRQKLG TVQAETAKSS FGDAKVSTRR  180
ALSSVRNNFK EIQRRLEIWL ARILGDLEGM LARDGASRIR EYILSPYASA VR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A3e-23154457Transcription factor LUX
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703061e-142HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLR7W6V71e-172R7W6V7_AEGTA; Two-component response regulator ARR18
STRINGEMT172821e-173(Aegilops tauschii)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G05090.12e-26G2-like family protein