PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT16677
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 279aa    MW: 30262.5 Da    PI: 6.4253
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT16677genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.91.9e-321670155
   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              ++rlrWt eLHe+Fveav+qLGG+++AtPk +l++m+ +gLt++hvkSHLQkYRl
  EMT16677 16 RQRLRWTDELHEQFVEAVTQLGGPDRATPKGVLRIMGTPGLTIYHVKSHLQKYRL 70
              58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8141373IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.3E-311571IPR009057Homeodomain-like
SuperFamilySSF466891.97E-171570IPR009057Homeodomain-like
TIGRFAMsTIGR015579.0E-251771IPR006447Myb domain, plants
PfamPF002493.8E-91869IPR001005SANT/Myb domain
PfamPF143798.6E-24102148IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGSNDGPNSK ANLAARQRLR WTDELHEQFV EAVTQLGGPD RATPKGVLRI MGTPGLTIYH  60
VKSHLQKYRL AKYIPDSSAD GNKADNKDPG DSLAGLDGSS GMQISEALKL QMEVQKRLHE  120
QLEVQRQLQL RIEAQGKYLK KIIEEQQRFG GGGIKSETPG AGATVTVSSD QFPDSERTDP  180
STPAPTSESA SQGGAFKRDS GSQTEAIKSP CHDEPLLTAD SNCHPGSPTL SPKHERAAKR  240
QRGSDAEFPE AELSLPQHIF ESSSGPEFQQ CSVPYYSGH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-231673158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3657330.0AK365733.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2037A13.
GenBankAK3738550.0AK373855.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3045J14.
GenBankAK3752400.0AK375240.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3089A21.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020180683.10.0myb family transcription factor PHL7-like isoform X1
RefseqXP_020180688.10.0myb family transcription factor PHL7-like isoform X1
RefseqXP_020180697.10.0myb family transcription factor PHL7-like isoform X1
RefseqXP_020180704.10.0myb family transcription factor PHL7-like isoform X1
RefseqXP_020180710.10.0myb family transcription factor PHL7-like isoform X1
SwissprotQ9SJW07e-91PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A3B6MQG40.0A0A3B6MQG4_WHEAT; Uncharacterized protein
TrEMBLA0A453KKJ10.0A0A453KKJ1_AEGTS; Uncharacterized protein
STRINGTraes_5DL_EB47672ED.40.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22203896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-60G2-like family protein