PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT16225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 293aa    MW: 32636.9 Da    PI: 6.3175
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT16225genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.18.4e-332680155
   G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              k+rlrWtp+LH+rFv+av++LGG++kAtPk +l+lm +kgLtl+h+kSHLQkYRl
  EMT16225 26 KQRLRWTPDLHDRFVHAVARLGGPDKATPKGVLRLMAMKGLTLYHLKSHLQKYRL 80
              79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.4E-312381IPR009057Homeodomain-like
PROSITE profilePS5129412.3352383IPR017930Myb domain
SuperFamilySSF466894.84E-162682IPR009057Homeodomain-like
TIGRFAMsTIGR015575.2E-242681IPR006447Myb domain, plants
PfamPF002491.8E-72879IPR001005SANT/Myb domain
PfamPF143791.5E-19147191IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MEGMSYGGGA AGAGAGAAAL SPRDPKQRLR WTPDLHDRFV HAVARLGGPD KATPKGVLRL  60
MAMKGLTLYH LKSHLQKYRL GKQSKKSTDL ELANSGDFTT QDINFQIGAP LVVPAERDTG  120
RADLSAIIRH LEINNNYFCL HGLEIPLEDT LRYQIQVQRE LCEQLEVQKK LQMRIEAQGR  180
YLKEILEKAQ ENISFDANGS VGLENTRSQL TDFNLALPGL SDNGTQVYEE SGEQLVKHMS  240
DDNLHDNNLD FQLYRVRSQE AKSVECTPKT EDLLLLDLNI KGGYDLSSRG MQG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-212682157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3715121e-158AK371512.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2136B23.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020164352.10.0myb family transcription factor PHL11-like
TrEMBLN1QYN50.0N1QYN5_AEGTA; Myb family transcription factor APL
STRINGEMT162250.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39403470
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.13e-59G2-like family protein