PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT12202
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 182aa    MW: 19830.1 Da    PI: 6.5078
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT12202genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.87.7e-31152455
   G2-like  4 lrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
              +rWt+ LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  EMT12202  1 MRWTTSLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 52
              79*************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.05E-14153IPR009057Homeodomain-like
PROSITE profilePS512949.082155IPR017930Myb domain
TIGRFAMsTIGR015576.2E-23153IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.9E-27152IPR009057Homeodomain-like
PfamPF002492.4E-7151IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MRWTTSLHAR FVHAVELLGG HERATPKSVL ELMDVKDLTL AHVKSHLQMY RTIKTTDHKP  60
AAASSYGQAK TIIDIPDDSS FDIANTSGSE SSVQQSNLDG NEHGSNMCAL WSNNSSRGAW  120
SFHGKSRSDA NPGDIKSFED VQSQCPNVVA DDAADLMSAP FRLSELVVGA KKPNLDFTLG  180
RM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-18154558Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0369119e-73BT036911.1 Zea mays full-length cDNA clone ZM_BFb0147F05 mRNA, complete cds.
GenBankKJ7268299e-73KJ726829.1 Zea mays clone pUT3369 G2-like transcription factor (GLK47) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020156179.11e-132probable transcription factor KAN2 isoform X1
SwissprotQ9C6165e-36KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A3B6QJP81e-131A0A3B6QJP8_WHEAT; Uncharacterized protein
TrEMBLM8B6271e-133M8B627_AEGTA; Putative Myb family transcription factor
STRINGEMT122021e-134(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP94383445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17695.15e-37G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]