PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11879
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 395aa    MW: 42145 Da    PI: 7.2587
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11879genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.58e-51111391128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
               +ppGfrFhPt+eel+++yL kkv++++++l +vi++vd++k+ePwd+++  ++ +  +++wy Fs++dkky+tg+r+nrat++g+Wkatg+dk+++s    
  EMT11879  11 VPPGFRFHPTEEELLTYYLSKKVASQRIDL-DVIPDVDLNKLEPWDIQArcRIGTgPQNDWYLFSHKDKKYPTGTRTNRATAAGFWKATGRDKPIYS-AAG 109
               69****************************.9***************953444443456**************************************.777 PP

       NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                +g++ktLvfykgrap+g+k+dW+mheyrl
  EMT11879 110 RIGMRKTLVFYKGRAPHGHKSDWIMHEYRL 139
               8***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.24E-557149IPR003441NAC domain
PROSITE profilePS5100553.67911191IPR003441NAC domain
PfamPF023652.2E-2612139IPR003441NAC domain
SuperFamilySSF1019418.24E-55179191IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSISVNGQSV VPPGFRFHPT EEELLTYYLS KKVASQRIDL DVIPDVDLNK LEPWDIQARC  60
RIGTGPQNDW YLFSHKDKKY PTGTRTNRAT AAGFWKATGR DKPIYSAAGR IGMRKTLVFY  120
KGRAPHGHKS DWIMHEYRLD DAVAPATNTV FAAGDASSYY SGISSPVRGV AGDQSPLAQE  180
DGWVICRVFK KNIVAQHQAG QSGGRGGGAA SNKLVGAGAV ERSQSNCSST VTAASDPAKA  240
QMMHCAGSDD GLDNILRYMD RSSAASCKQE TKPTNPSSSP LDQLINSACH SGSSTLYEKF  300
MKLPPLEYGG DWDALDRLAA YELNGLSDAA TAKTTNGMSY IVDELGGATT AYTSGGTAHS  360
SSLTGGGDGD LWSLARSVSS LHADLTMTCF NAVGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-451113915140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3678010.0AK367801.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2062J03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020149598.10.0NAC domain-containing protein 66-like
SwissprotQ84WP67e-99NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A453QJV50.0A0A453QJV5_AEGTS; Uncharacterized protein
TrEMBLM8BYI00.0M8BYI0_AEGTA; NAC domain-containing protein 43
STRINGEMT118790.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP159738112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.13e-88NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]