PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11720
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 363aa    MW: 39629.8 Da    PI: 7.3232
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11720genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.7e-3194147255
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               prlrWtpeLH++Fv+a+++LGG+++AtPk +l+lm+v gL++ hvkSHLQ+YR+
  EMT11720  94 PRLRWTPELHHCFVRAIHRLGGQDRATPKLVLQLMNVRGLSIGHVKSHLQMYRS 147
               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.2990150IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-3090148IPR009057Homeodomain-like
SuperFamilySSF466892.51E-1591148IPR009057Homeodomain-like
TIGRFAMsTIGR015575.5E-2393149IPR006447Myb domain, plants
PfamPF002492.7E-995146IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MEASKGGDGS SGASASNDDS TVEEEGASRQ EQEDACRGNS LSSSSAPGSW GAAASNDDST  60
VEEEGASRQE QEDACRGNSL SSSSVRPYVR SKNPRLRWTP ELHHCFVRAI HRLGGQDRAT  120
PKLVLQLMNV RGLSIGHVKS HLQMYRSKKI DDSGQVIGHL PLPHAFHHRQ SGAGTMLSRF  180
GAAAWPPWRS FHEPYWAHGR PFLGSKTYNS LEAEAEAAFL RSRAQHVARA ASSNPGLMMQ  240
SGCPSRNDHH TMNHQPKRLL QLTVRNDNDT HVLLDLDLGL SLGLPVPMRE AKRRRSGCGW  300
VKEGPDEKGA DEEQVDETST ATMLSLSLFS PRDAPRKMSS TSASDHAVDE HATRRASTLD  360
LTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1795149357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1795149357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1795149357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1795149357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3736460.0AK373646.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv3038H19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020183942.10.0transcription factor LUX-like
TrEMBLM8BDH60.0M8BDH6_AEGTA; Putative Myb family transcription factor
STRINGEMT117200.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-37G2-like family protein