PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11045
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 276aa    MW: 30944.3 Da    PI: 6.6352
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11045genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.93.4e-52191511129
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk...k 96 
               lppGfrFhPtdee+v++yL++k+++ ++++  +++ v+++++ePwdLpk  k+  +++ew+fF+++d+ky+tg+r+nratksgyWkatgkdke+++    +
  EMT11045  19 LPPGFRFHPTDEEVVTHYLTPKIRNPDFSC-LMVSYVNLNNTEPWDLPKkaKMGVGQSEWFFFVHKDRKYPTGTRTNRATKSGYWKATGKDKEIFRGtglG 118
               79*************************999.679*************95346666899*************************************987767 PP

       NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                 lvg+kktLvfy+grap g+kt Wvmheyrle
  EMT11045 119 AVLVGMKKTLVFYRGRAPGGQKTPWVMHEYRLE 151
               777****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5815174IPR003441NAC domain
PROSITE profilePS5100556.30819174IPR003441NAC domain
PfamPF023659.8E-2920150IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MSDVTAVMHL RGEEPWLALP PGFRFHPTDE EVVTHYLTPK IRNPDFSCLM VSYVNLNNTE  60
PWDLPKKAKM GVGQSEWFFF VHKDRKYPTG TRTNRATKSG YWKATGKDKE IFRGTGLGAV  120
LVGMKKTLVF YRGRAPGGQK TPWVMHEYRL EGELPHRLPR SAKDDWAVCR LLNKDMAAKN  180
APQMAPAADA GMEEEDPFAF LDELLNSDDL LNNADLLDNA DPPMLMDSPS GAIDFAGASS  240
STSSVALPIG PYMEHLTRKT EPPAPQQQSP NYMWKM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-471718018174NAC domain-containing protein 19
3swm_B2e-471718018174NAC domain-containing protein 19
3swm_C2e-471718018174NAC domain-containing protein 19
3swm_D2e-471718018174NAC domain-containing protein 19
3swp_A2e-471718018174NAC domain-containing protein 19
3swp_B2e-471718018174NAC domain-containing protein 19
3swp_C2e-471718018174NAC domain-containing protein 19
3swp_D2e-471718018174NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020166614.10.0NAC domain-containing protein 79-like
SwissprotQ9FK448e-75NAC87_ARATH; NAC domain-containing protein 87
TrEMBLA0A453AN380.0A0A453AN38_AEGTS; Uncharacterized protein
TrEMBLM8BBK40.0M8BBK4_AEGTA; Protein CUP-SHAPED COTYLEDON 3
STRINGEMT110450.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18270.17e-73Arabidopsis NAC domain containing protein 87
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]