PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09847
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 976aa    MW: 108924 Da    PI: 10.2104
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09847genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding29.32e-09370406239
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkq 39 
                      grW+++Ed++l   vk++ +g+W++Ia+ ++ gRt  q
         EMT09847 370 GRWSEDEDKRLMVSVKLFRSGSWNKIAQFLP-GRTQSQ 406
                      8******************************.***765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.76264362IPR017877Myb-like domain
SMARTSM007170.011268364IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.2E-7269301IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-13337409IPR009057Homeodomain-like
SuperFamilySSF466891.03E-13343410IPR009057Homeodomain-like
PROSITE profilePS5129410.097363420IPR017930Myb domain
SMARTSM007170.0044368418IPR001005SANT/Myb domain
PfamPF002492.1E-8370406IPR001005SANT/Myb domain
CDDcd001679.30E-7371415No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 976 aa     Download sequence    Send to blast
MAPAPCNELD QIAQGSARSF PSAWTTAVAA TDGLSDEEEE EDLALVRSIR ENLHLNKASP  60
SSPRPICIWP PSFMEDDLET LRAIQRRFSH YHSGTSTGPL ENMKNEASKG GDDEFIAHRP  120
GEEDVQSKNT KALTQTGFPK AALLLVDALK KNRACQKFIR RKMINIEAKI EVNKDLRDRV  180
KCLMDYQLSC RRSFSNFLCQ KVDPRVRLIS SEKQSAQSAK EQIIRHLQKS ILFLQNKCKM  240
SPLLLGPAEN PHIEKYKVVL KQFPISLQKH SWSDTEKDRL AKGIKQQYQE MLIKDSMKNG  300
SSSGDFSAVD MAYALTNTGG NFEATHEILR SVLPLVNWDY IAAMYLPGRS GAECESRWRK  360
TLNPERKRVG RWSEDEDKRL MVSVKLFRSG SWNKIAQFLP GRTQSQSSER RWKRLCQDEL  420
PLVIAANQVK KTIFQTNFVD RETERPAICP SDFPSLVYSK VDRRDENTAS DQVKKPRKRS  480
RRSCADNVPS GDPLKSSADV AAKRMRGSIS VDDESTLDIL GGPISFDDEA PANRQRVPTF  540
VGKEGTGKKR TRGSGSVGNE GAVKKKMRGS VSVGDGRAVK NRMRGSVSVD NQGSTTKRKR  600
VSRKSAKGNS TTDGGVNACE LALPSVPSEA CAERGIDTGN TNKMKWKSTP RPKQINMAEG  660
TVDEYSRLAD CIPFARGNGT SRNNNRSQSV QSLVSCLLYK EGFPYPINIG GRSNLVKLEK  720
QEDTWAKSSL QAFVDFSGNP VMESLLCHSA SQFKHWSTFL MYTHYFYFFA AKTFNLFIFN  780
YGSTTNTRNN NKNTSRYVDH LATTTSTEAT KGAPLSSPLP SGSWANFVVV DGREVVVLRP  840
HKTNAPEQNH RGEECRSKGS NLKTHKRRRM TNDEQIQTNP SKTDLPETHL HTPTMMLDAS  900
PERGLGGETF IASSRSHRHL TFLSRTQTRT KLEKRSKNEA LPPARAEIHS ASMTLRPLET  960
GRTGVGTGGT VGGREP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1473481KKPRKRSRR
2546552GKKRTRG
3861867LKTHKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752712.11e-149PREDICTED: uncharacterized protein LOC100828457 isoform X3
RefseqXP_014752713.11e-149PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLM8AZC90.0M8AZC9_AEGTA; Myb-like protein L
STRINGMLOC_5739.11e-178(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.12e-50myb domain protein 4r1