PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09782
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family B3
Protein Properties Length: 644aa    MW: 72174.6 Da    PI: 8.4813
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09782genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B350.53.8e-161111881394
               TT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
        B3  13 sgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
               ++ +++pkkf++++gg    s+t+ le+++g+ + +++  +k+ g +vl +GW+ F ++++++e+D+++F+++++s+fe +v
  EMT09782 111 RHGMIIPKKFIDNFGGM--ISRTIELESSNGNMYVFEV--SKRMGNTVLHRGWQAFIDEHHIEENDSLLFRHIEKSRFEILV 188
               567********888776..7889***************..*********************************999996655 PP

2B349.95.6e-16315402187
               EEEE-..-HHHHT.T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
        B3   1 ffkvltpsdvlks.grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgr 87 
               f+ v++ps+v ++ + lv+pk +a eh    ++s+t+tl+   ++++W  ++ +rk + + ++ + GW +Fv++ ++++gD+++F+++ +
  EMT09782 315 FVAVMKPSNVKSQtSALVIPKGYAVEHFP--PKSQTVTLQRpGKSKKWHPRFHIRKDKHGsILCGPGWFDFVRDTRVQVGDICIFERMMK 402
               7789999999988788***********84..47789*****5566*******77555544499***********************6533 PP

3B354.12.9e-17547640799
               .-HHHHT..T-EE--HHH.HTT---..--SEEEEEE.TTS-EEEEEE..EEETTE.EEE-TTHHHHHHHHT--TT-EEEEEE-SS.SEE..EEEEE-S CS
        B3   7 psdvlks..grlvlpkkfaeehggkkeesktltled.esgrsWevkliyrkksgr.yvltkGWkeFvkangLkegDfvvFkldgr.sefelvvkvfrk 99 
               +s+v+ +    +++ +k+a+e+   +++ +t+tl   e++++Wevk+  + + g   +l++GW+eF+++n+Lk +D+++F+l+ + ++ +++v ++r+
  EMT09782 547 KSSVGDNslYAVTICRKYAAEYL--PAGAQTVTLLRaEKSKTWEVKV--NPRIGNaKMLKGGWREFAHDNHLKLKDICLFQLMTDqRKLTMMVDIIRH 640
               566666523346999****9993..334457777665999*******..544444489*************************888*********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.9E-1995194IPR015300DNA-binding pseudobarrel domain
SMARTSM010191.3E-798192IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.1E-1898193IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.7399192IPR003340B3 DNA binding domain
CDDcd100178.12E-16100190No hitNo description
PfamPF023623.7E-14111188IPR003340B3 DNA binding domain
SuperFamilySSF1019366.87E-20311402IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-23312420IPR015300DNA-binding pseudobarrel domain
CDDcd100171.70E-19313418No hitNo description
SMARTSM010197.0E-11315420IPR003340B3 DNA binding domain
PfamPF023623.1E-14315405IPR003340B3 DNA binding domain
PROSITE profilePS5086311.984316420IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.103.4E-19533641IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019369.81E-17534641IPR015300DNA-binding pseudobarrel domain
CDDcd100173.34E-16539639No hitNo description
SMARTSM010193.2E-7541641IPR003340B3 DNA binding domain
PROSITE profilePS5086311.801543641IPR003340B3 DNA binding domain
PfamPF023628.5E-16547640IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MGLEPISNFS RSCGSLYNYT EFGGASCQDE FQVLDLLHCW LVERSDWNAG CTLALEQQHC  60
NPGAGIFDNP VHGTGLAASQ MEKLCDCCKR YADHLDEKMK CFRRHMGADF RHGMIIPKKF  120
IDNFGGMISR TIELESSNGN MYVFEVSKRM GNTVLHRGWQ AFIDEHHIEE NDSLLFRHIE  180
KSRFEILVLD SDDCEKVFFC PGINIVSNVE ERGADSVNIS NSSRDYATRS SGSKRLCTGE  240
DTENENTDAI YSSSEDSEEG TEDIPSEHES SFELDDGHTP SRQDYVLARG RTLSRVQDEK  300
VTTLIQDVGA EIPVFVAVMK PSNVKSQTSA LVIPKGYAVE HFPPKSQTVT LQRPGKSKKW  360
HPRFHIRKDK HGSILCGPGW FDFVRDTRVQ VGDICIFERM MKKGTGRTFS SLRVHLLRKS  420
MLHSGGSGTG PKRVSLTHGK TRVNSATPKG ARTTDGRTRA KATSTASVRK EPGDEMFPGG  480
NAPSSVHSHG HEARQGPVES NKSRGPRKRP YIISSTACLT REQEMNVDKR ARSLQSDVPI  540
YASVMNKSSV GDNSLYAVTI CRKYAAEYLP AGAQTVTLLR AEKSKTWEVK VNPRIGNAKM  600
LKGGWREFAH DNHLKLKDIC LFQLMTDQRK LTMMVDIIRH NEKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020189914.10.0B3 domain-containing protein Os03g0620400-like
TrEMBLM8AZ830.0M8AZ83_AEGTA; B3 domain-containing protein
STRINGEMT097820.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58531172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.11e-13B3 family protein