PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09592
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family HD-ZIP
Protein Properties Length: 273aa    MW: 31039.8 Da    PI: 7.8038
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09592genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.61.2e-1964115556
               SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
  Homeobox   5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
               +++  eq+++Le+ Fe +++++ e+++++A+ lgL  rqV vWFqNrRa++k
  EMT09592  64 RRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWK 115
               467789*********************************************9 PP

2HD-ZIP_I/II128.42.9e-4162151291
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                  kkrrl+ eqv++LE+sFe+++kL+perK+++ar+Lgl+prqvavWFqnrRAR+ktkqlE+d++aL++++dal+++ ++L++++++L++e+
     EMT09592  62 KKRRLALEQVRALERSFETDNKLDPERKARIARDLGLHPRQVAVWFQNRRARWKTKQLERDFNALRARHDALRADCDALRRDKDALAAEI 151
                  9*************************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.9E-1960121IPR001356Homeobox domain
SuperFamilySSF466891.35E-1860119IPR009057Homeodomain-like
PROSITE profilePS5007116.55262117IPR001356Homeobox domain
CDDcd000863.74E-1662118No hitNo description
PfamPF000467.0E-1764115IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-1969116IPR009057Homeodomain-like
PRINTSPR000313.5E-58897IPR000047Helix-turn-helix motif
PROSITE patternPS00027092115IPR017970Homeobox, conserved site
PRINTSPR000313.5E-597113IPR000047Helix-turn-helix motif
PfamPF021836.2E-13117151IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MKRQIKRPTR SQESPEPGEK LAFAEKENLL AAYMEHDEPE LEEADEEEEE EERAMSCGLG  60
GKKRRLALEQ VRALERSFET DNKLDPERKA RIARDLGLHP RQVAVWFQNR RARWKTKQLE  120
RDFNALRARH DALRADCDAL RRDKDALAAE IFFRKLAFLR PKKSSNRLTG CPRGSKARDV  180
YYATFFLARP PPAAPPTGCS SLPMLEPKWP GAYPYDGSRS GGYGFTEEWL AGSDAIVNDG  240
SSAFFSEEHV SNLNFGWCSS GAEGFDLQSY CKK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1109117RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3539650.0AK353965.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1004B20.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020190062.11e-143homeobox-leucine zipper protein HOX13-like
SwissprotQ10QP37e-84HOX13_ORYSJ; Homeobox-leucine zipper protein HOX13
TrEMBLM8AYN40.0M8AYN4_AEGTA; Homeobox-leucine zipper protein HOX13
STRINGEMT095920.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65310.26e-29homeobox protein 5
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]