PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09351
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 284aa    MW: 31894.4 Da    PI: 8.0291
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09351genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74.2e-3148101255
   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               prlrWtpeLH++Fv+ave+LGG++ AtPk +l+lm+v gL++ hvkSHLQ+YR+
  EMT09351  48 PRLRWTPELHHCFVRAVERLGGQDCATPKLVLQLMNVRGLSIGHVKSHLQMYRS 101
               9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.06444104IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.7E-3044102IPR009057Homeodomain-like
SuperFamilySSF466891.97E-1545102IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-2347103IPR006447Myb domain, plants
PfamPF002491.1E-949100IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGTSSMGNDG SSAASNDDST VEEEGGQDMT RAGDSSSSVR PYVRSKNPRL RWTPELHHCF  60
VRAVERLGGQ DCATPKLVLQ LMNVRGLSIG HVKSHLQMYR SKKIDHSGQV IIGHLQQGGQ  120
VYNYAHLPFH HRVSGAGTML SRFGTRPCPP WKGSWHEPYW LHGHRLLGSK PYYSSSARAH  180
HDEAPLRARA QHVSGYNPAL IVQESCSSRN DHHAMNRYNY ERRPMQAATM VDNNDHIHGR  240
DIDLDLSLDI GGGQRLEMKS KRGCTRWGKQ AEEDDDHQVD VNEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-1649103357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-1649103357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-1649103357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-1649103357Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1072972e-77AK107297.1 Oryza sativa Japonica Group cDNA clone:002-126-C05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020151276.10.0uncharacterized protein LOC109736464
TrEMBLA0A3B6JIE40.0A0A3B6JIE4_WHEAT; Uncharacterized protein
STRINGTraes_4DS_99EC36CD4.10.0(Triticum aestivum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44083671
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.15e-38G2-like family protein