PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09301
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 303aa    MW: 33433.9 Da    PI: 9.1674
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09301genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.11.7e-3279133155
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
               k+rlrWt++LH+rFv+a++qLGG+++AtPk +l +m+v+g+t++hvkSHLQkYRl
  EMT09301  79 KQRLRWTSDLHSRFVDAIAQLGGPDRATPKGVLTVMGVPGITIYHVKSHLQKYRL 133
               79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.17176136IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-3077134IPR009057Homeodomain-like
SuperFamilySSF466892.15E-1678133IPR009057Homeodomain-like
TIGRFAMsTIGR015574.2E-2579134IPR006447Myb domain, plants
PfamPF002497.2E-781132IPR001005SANT/Myb domain
PfamPF143795.1E-24169214IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MGGCFAQRFC RPSGRDRGSV RRIAVELRVR GRTLMMYHAK KFSVPFAPQR AQNSEHVSNI  60
GAFGGSNISN PANPVGSGKQ RLRWTSDLHS RFVDAIAQLG GPDRATPKGV LTVMGVPGIT  120
IYHVKSHLQK YRLAKYIPES PAEACVGSKD EKKDSSDSFS NADSAPGSQI NEALKMQMEV  180
QKRLHEQLEV QKQLQLRIEA QGKYLQMIIE EQQKLGGSLE GSEERKLSHS PPTLDDYPDS  240
IQPSPKKPRL DDLSTDAVRG VAQPGFESHL VGPWDQELCP KTNICDPAFQ VDEFKANPGL  300
SKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2278136159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6256800.0AY625680.1 Triticum aestivum MYB transcription factor (MYB80) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020198211.10.0myb family transcription factor PHL7-like isoform X1
SwissprotQ9SJW01e-67PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLM8B5R00.0M8B5R0_AEGTA; Myb family transcription factor APL
STRINGEMT093010.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79133343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-62G2-like family protein