PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT08108
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family G2-like
Protein Properties Length: 458aa    MW: 49236.7 Da    PI: 10.3181
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT08108genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.61e-31233288156
   G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
               k+r++W+peLH++Fv a++qLGG+++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  EMT08108 233 KARRCWSPELHRQFVTALHQLGGPQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 288
               68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.514230290IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.1E-29231291IPR009057Homeodomain-like
SuperFamilySSF466891.58E-16231291IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-25233288IPR006447Myb domain, plants
PfamPF002492.0E-7235286IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MGLDVGEIGM GADLSLDLKM FAAKSLGRVG EAPAAAMDDC IRRLEEEKSK IEVFRRELPL  60
CARLLADVID VMKKEVEEKK RGGDRGEDRE DAGAGDKSNW MSTAQLWTGD SVRGDDASEK  120
QDERRRSSEP ESRDGAGLPS KAVGSGAPAF APPSLRKDDK AVRMPDLPFL SPAPIKTSPA  180
VATGGAEESR RQLVGFAQEA ARAAAALAPA APSLSLQAQS QQTAQQQQQQ ARKARRCWSP  240
ELHRQFVTAL HQLGGPQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHNR RAPGSPAANR  300
PIVLMGGLWI TQEQSSSQSG GSPPGPLNFS SSGVAASSVT LGETGKNSTP IVSPEQGAEV  360
AHSVSGKGNC LSLRNGGVLR KYKESKITSA EPWNPSARPT PIVSTTTEGL PPRWASPIVR  420
RLRLADAATV ILRPNRTCAR YERRVGLWFS RANGRAVI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-13233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-13233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-13233286154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-13233286154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519320.0JF951932.1 Triticum aestivum clone TaMYB49 MYB-related protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020173713.10.0myb family transcription factor EFM-like
TrEMBLM8BYT60.0M8BYT6_AEGTA; Two-component response regulator ARR1
STRINGEMT081080.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP181737107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-38G2-like family protein