PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07892
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 694aa    MW: 76931.3 Da    PI: 4.5946
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07892genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.22.7e-5291421128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.... 95 
               lp GfrFhPtdeelv +yLk k++g+  ++ evi+e+d++k+ePwdLp k  +++e+ ew+fF+++d+ky++g+r+nrat++gyWkatgkd+ ++sk    
  EMT07892   9 LPLGFRFHPTDEELVRHYLKGKITGQIKNEVEVIPEIDVCKCEPWDLPdKaLIRSEDPEWFFFAPKDRKYPNGSRSNRATEAGYWKATGKDRVIKSKgekk 109
               699***********************988889***************96336677888**************************************97655 PP

       NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
               k++ +g+kktLvf++grapkge+t W+mheyr 
  EMT07892 110 KQHMIGMKKTLVFHRGRAPKGERTGWIMHEYRT 142
               5556***************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-583163IPR003441NAC domain
PROSITE profilePS5100556.9929163IPR003441NAC domain
PfamPF023651.2E-2710141IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MTVMELKALP LGFRFHPTDE ELVRHYLKGK ITGQIKNEVE VIPEIDVCKC EPWDLPDKAL  60
IRSEDPEWFF FAPKDRKYPN GSRSNRATEA GYWKATGKDR VIKSKGEKKK QHMIGMKKTL  120
VFHRGRAPKG ERTGWIMHEY RTTEPEFESG EQGGYVLYRL FQKQLEKTER SIPEEMDRSG  180
YSPTPSRSTP DNMEANEEAI TLINKEFPES GLHGCPIELP GTIDTPGTPV TRWLADRNGN  240
SGIDEANVLG MPFHGNVDES PKADMPVGSL AHLIDSQTKN LGSHEFATVS APMLSLDDVD  300
KLLLQLPHNS VEDFLNETIA DPDEHSSTAC KVQYDSDTVF MQAQGELLYD GPNWFGNFLS  360
DDTNPQQSGL YENATLLPYG TNPDVLSMDS GDESLQDLFN SMDDSSGQND VWSNGFGFNP  420
MHQQLQSTVH PNYIFSQQGI APRRLRLLDS LSDVNVESRE SMTRDEHEDE ESDIVTSKYT  480
SESVESSADV DDSESTGVTI MTRRRALTKS APSDCDDAQS TGITIMARRP APSSNMPSNE  540
ADAEATGINI MSTSTDSSFT TEQGTAVRRL RLQSNLDAGS CSSVDGASSC IIKHGSENKG  600
LEAEIEEHVD TNFPDDAGNS HADEQMYMPD HEANSGMRLR KTAEKSDKEN KQECGLQPHV  660
RAPRKRGGFA ARMILPVLSV ALLVLVSVGI YGWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-46816416166NO APICAL MERISTEM PROTEIN
1ut4_B2e-46816416166NO APICAL MERISTEM PROTEIN
1ut7_A2e-46816416166NO APICAL MERISTEM PROTEIN
1ut7_B2e-46816416166NO APICAL MERISTEM PROTEIN
3swm_A2e-46816419169NAC domain-containing protein 19
3swm_B2e-46816419169NAC domain-containing protein 19
3swm_C2e-46816419169NAC domain-containing protein 19
3swm_D2e-46816419169NAC domain-containing protein 19
3swp_A2e-46816419169NAC domain-containing protein 19
3swp_B2e-46816419169NAC domain-containing protein 19
3swp_C2e-46816419169NAC domain-containing protein 19
3swp_D2e-46816419169NAC domain-containing protein 19
4dul_A2e-46816416166NAC domain-containing protein 19
4dul_B2e-46816416166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2497490.0AK249749.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf54a18, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020181256.10.0protein NTM1-like 9 isoform X2
TrEMBLA0A3B6TK800.0A0A3B6TK80_WHEAT; Uncharacterized protein
TrEMBLA0A453RX520.0A0A453RX52_AEGTS; Uncharacterized protein
TrEMBLM8ATU20.0M8ATU2_AEGTA; NAC domain-containing protein 78
STRINGEMT078920.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP51723859
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G33060.19e-70NAC 014