PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07531
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB
Protein Properties Length: 926aa    MW: 102986 Da    PI: 8.5368
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07531genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding24.18.5e-08394438246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      ++WT+ E+++l+  v++ G+++W  Ia  +g+ Rt+ qc  r+q 
         EMT07531 394 KAWTACEEKRLILTVQEKGMHNWINIAVALGTQRTPFQCLARYQR 438
                      58*****************************99**********96 PP

2Myb_DNA-binding41.82.6e-13447491248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        WT+eEd++l+ av+ +G + W ++++ +  gR ++qc +r++k l
         EMT07531 447 RTWTKEEDLQLLAAVQTFGCN-WQLVSANLV-GRIGNQCSNRYRKTL 491
                      68*****************88.*********.************975 PP

3Myb_DNA-binding43.76.3e-14499544248
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      grW+++Ed++l   vk++ +g+W++Ia+ ++ gRt  qc +rw+++l
         EMT07531 499 GRWSEDEDKRLMVSVKLFRSGSWNKIAQFVP-GRTQSQCSERWRNVL 544
                      8******************************.************986 PP

4Myb_DNA-binding33.78.2e-11551594246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g W +eEd +l+  v++ G+  W++Ia  m  +Rt+++c  rw  
         EMT07531 551 GEWRPEEDSKLLASVHEVGPC-WSKIAGAMIPHRTDNMCLRRWKR 594
                      79*****************88.*****99999***********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.808289387IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.603.4E-5291312IPR009057Homeodomain-like
SMARTSM007170.21293389IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-5359374IPR009057Homeodomain-like
SuperFamilySSF466896.97E-15368436IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-6375407IPR009057Homeodomain-like
PROSITE profilePS500908.072388440IPR017877Myb-like domain
SMARTSM007174.9E-4392442IPR001005SANT/Myb domain
PfamPF002492.8E-6394438IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.9E-11408445IPR009057Homeodomain-like
SuperFamilySSF466893.8E-19426491IPR009057Homeodomain-like
PROSITE profilePS5129419.246441495IPR017930Myb domain
SMARTSM007172.1E-12445493IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.9E-15446491IPR009057Homeodomain-like
PfamPF002496.9E-12447490IPR001005SANT/Myb domain
CDDcd001673.45E-9448491No hitNo description
PROSITE profilePS5009010.557493544IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.3E-18494547IPR009057Homeodomain-like
SuperFamilySSF466891.13E-24495592IPR009057Homeodomain-like
SMARTSM007171.8E-11497546IPR001005SANT/Myb domain
CDDcd001671.47E-10500544No hitNo description
PfamPF139214.4E-14501561No hitNo description
PROSITE profilePS5129417.042545600IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.5E-15548599IPR009057Homeodomain-like
SMARTSM007174.8E-10549598IPR001005SANT/Myb domain
CDDcd001679.94E-9552595No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MDFYSDDDSD PDFDEGLQED LDLVRRSCII AGADPDAAVA QASSYLTVPA ATTTAAAAAA  60
KATDGSSDEG EGEDEDEDLA LVRSIRENLH LNKASPSSPR PICAWPPSDA EDDEEDDLET  120
LRAIQRRFSH YHSGTSTGPL ENMKNEASKG GDDEFIAHQP GEEDVQKKNM NANTQTGFPK  180
AALLLVDALK KNRACQKFIR RKMINIEAKI EVNKDLRDRV KCLMDYQYSC RRSFGKVLCQ  240
KVDPRVRLIS SQKQSAQSAK NKYKTPALLL GPAENPHVEK YKAVLKQFPV SLQKHPWSDI  300
EKDRLAKGIK QQYQEALIKD SMKNGSSSGD FSAVDMAYAL TNTVGNFEAT PEILRSVLPL  360
VNWDYVAAMY LPGRSGAECE SRWLNHDDPL INHKAWTACE EKRLILTVQE KGMHNWINIA  420
VALGTQRTPF QCLARYQRSL NPHILKRTWT KEEDLQLLAA VQTFGCNWQL VSANLVGRIG  480
NQCSNRYRKT LIPERKRVGR WSEDEDKRLM VSVKLFRSGS WNKIAQFVPG RTQSQCSERW  540
RNVLDPDIEH GEWRPEEDSK LLASVHEVGP CWSKIAGAMI PHRTDNMCLR RWKRLCQDEL  600
PLMIAANQVK KSIFQTNFVD RETERPAICP SDFPSLVYSK VDKGDENTVR IGAENQTGED  660
ITVSDGVNNS SRCHHSKARK RKVTTDGDVV VQPGMRGSIS VDKELTLDIL GGPISFDNEA  720
PTNQKRDPTS VGKEGTAKKR TRGSVSVGNE GAVKKKMRGS ISVGDGRAVK NRMRGSVSID  780
NQGNTTKRKR VSRKSAKGNS KTDGEVNTCE MDLPSVPSEA AAERGIHTGN TNKMKRKSTP  840
RPKLINMAEG TVDEYSRLAD CISFARGNGT SKNNSVMPIN NAVQSGGPSG ENLQMTIIDR  900
SNFLKLEKQE DRGAKVLIEH LNSSIA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C9e-233666173155MYB PROTO-ONCOGENE PROTEIN
1h89_C9e-233666173155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1736742AKKRTRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3685540.0AK368554.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2075O14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014752713.10.0PREDICTED: uncharacterized protein LOC100828457 isoform X5
TrEMBLM8B0J40.0M8B0J4_AEGTA; Myb-like protein L
STRINGMLOC_5739.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP65943543
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.11e-143myb domain protein 4r1