PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 411aa    MW: 44339.7 Da    PI: 6.6739
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07151genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49461712128
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvgl 102
               +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++++ +gl
  EMT07151  46 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSRPIGL 145
               79***************************.89***************7777899*********************************************** PP

       NAM 103 kktLvfykgrapkgektdWvmheyrl 128
               kktLvfy+g+apkg++++W+m+eyrl
  EMT07151 146 KKTLVFYSGKAPKGVRSSWIMNEYRL 171
               ************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5445215IPR003441NAC domain
PROSITE profilePS5100553.53545216IPR003441NAC domain
PfamPF023651.7E-2447171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MSRDVDEGSV SAATAGAGGG GEVGGEAAAG VSDEAAVDSH ENDLVMPGFR FHPTEEELIE  60
FYLRRKVEGR RFNVELITFL DLYRFDPWEL PAMAVIGEKE WFFYVPRDRK YRNGDRPNRV  120
TASGYWKATG ADRMIRGENS RPIGLKKTLV FYSGKAPKGV RSSWIMNEYR LPPPTTDADL  180
FYKGGFDRAC LCSLSEVSQN VSCMQSEISL CRVYKRSGID DGHGRPSSSN VQASSSARPG  240
TSRTIIPPAG QQVSSPLSTP MSPTQQPSFH GILGQGECSP APLPAIMDQA TAQLHQPPPP  300
PPPRPSAFAS AMSSTMSVAP AARSCTYSLM ALADAPMMGS SSTPGDELSR LVGHSQAYPN  360
HPAVGSHFLP SPSSSQIPPH GEMPVSPADK LWDWIHPDTT GSRDYGSSSF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-534721719166NO APICAL MERISTEM PROTEIN
1ut4_B4e-534721719166NO APICAL MERISTEM PROTEIN
1ut7_A4e-534721719166NO APICAL MERISTEM PROTEIN
1ut7_B4e-534721719166NO APICAL MERISTEM PROTEIN
4dul_A4e-534721719166NAC domain-containing protein 19
4dul_B4e-534721719166NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that acts as a floral repressor. Controls flowering time by negatively regulating CONSTANS (CO) expression in a GIGANTEA (GI)-independent manner. Regulates the plant cold response by positive regulation of the cold response genes COR15A and KIN1. May coordinate cold response and flowering time. {ECO:0000269|PubMed:17653269}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian regulation with a peak of expression at dawn under continuous light conditions (PubMed:17653269). Circadian regulation with a peak of expression around dusk and lowest expression around dawn under continuous light conditions (at protein level) (PubMed:17653269). {ECO:0000269|PubMed:17653269}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020183242.10.0transcription factor JUNGBRUNNEN 1-like
SwissprotQ9ZVP83e-92NAC35_ARATH; NAC domain-containing protein 35
TrEMBLM8AZH80.0M8AZH8_AEGTA; Putative NAC domain-containing protein 94
STRINGEMT071510.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-92NAC domain containing protein 35
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Okajima K
    Molecular mechanism of phototropin light signaling.
    J. Plant Res., 2016. 129(2): p. 149-57
    [PMID:26815763]
  3. Nakasone Y,Ohshima M,Okajima K,Tokutomi S,Terazima M
    Photoreaction Dynamics of LOV1 and LOV2 of Phototropin from Chlamydomonas reinhardtii.
    J Phys Chem B, 2018. 122(6): p. 1801-1815
    [PMID:29355019]