PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05948
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 375aa    MW: 41817.6 Da    PI: 5.045
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05948genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM152.71.7e-47141461128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k......kvkaeek.ewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
               l+pGfrFhPtd+elv +yL +kv+g + +   +i+ev++yk+ePw+Lp k        +++ k ewy F+ r++ky++g r  rat +g+Wk+tgkd++++
  EMT05948  14 LQPGFRFHPTDQELVIHYLYRKVHGLHDHH-AFIPEVHVYKHEPWELPgKsfspntD-ETGAKlEWYLFAVRARKYPNGLRMGRATVAGFWKSTGKDRPIM 112
               579***********************9776.78***************546766431.223336************************************* PP

       NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
               + +g  vg+kktLvf++grap g++t Wvmheyrl
  EMT05948 113 H-NGVIVGMKKTLVFHTGRAPCGTRTAWVMHEYRL 146
               *.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.27E-5612166IPR003441NAC domain
PROSITE profilePS5100552.02314166IPR003441NAC domain
PfamPF023654.3E-2416146IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MSDIAPVQPL DLLLQPGFRF HPTDQELVIH YLYRKVHGLH DHHAFIPEVH VYKHEPWELP  60
GKSFSPNTDE TGAKLEWYLF AVRARKYPNG LRMGRATVAG FWKSTGKDRP IMHNGVIVGM  120
KKTLVFHTGR APCGTRTAWV MHEYRLHGQR NHHVQDAYAL CRVFKKNTMA PLIDLSSDDD  180
TYEDPMQSVP GGVDTDKDLM EHVSDGADSD KDPKHYVLAG IESDKYPMQS ILGGGGTDND  240
PILVESDVAY AGKEQMESVL CSVSTDKDHI QVESEFDGVH AGKGKKPFLT DRGGTSTGNT  300
GGANKDNEGM QPVYAGASAD EENSVNAWYT AALAEEDNSW MQPPSYDDWY TRVDLDKDDS  360
LMQFIFGDVM LLNAD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-4341706169NO APICAL MERISTEM PROTEIN
1ut4_B1e-4341706169NO APICAL MERISTEM PROTEIN
1ut7_A1e-4341706169NO APICAL MERISTEM PROTEIN
1ut7_B1e-4341706169NO APICAL MERISTEM PROTEIN
3swm_A9e-4441709172NAC domain-containing protein 19
3swm_B9e-4441709172NAC domain-containing protein 19
3swm_C9e-4441709172NAC domain-containing protein 19
3swm_D9e-4441709172NAC domain-containing protein 19
3swp_A9e-4441709172NAC domain-containing protein 19
3swp_B9e-4441709172NAC domain-containing protein 19
3swp_C9e-4441709172NAC domain-containing protein 19
3swp_D9e-4441709172NAC domain-containing protein 19
4dul_A1e-4341706169NAC domain-containing protein 19
4dul_B1e-4341706169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020175147.10.0NAC domain-containing protein 59-like
TrEMBLM8BGT80.0M8BGT8_AEGTA; NAC domain-containing protein 74
STRINGEMT059480.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63173254
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.18e-59NAC domain containing protein 28