PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 360aa    MW: 40246.6 Da    PI: 4.7324
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05947genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM150.48.6e-47191511128
       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k....kvka...eek.ewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
               lppG+rFhPtd+elv+ +Lk+k+ g +++l ++i+ vd+y++eP +Lp k    +  +   + k ewyfF++r +ky+tg r +rat +g+Wk+tgkd++v
  EMT05947  19 LPPGYRFHPTDHELVNWFLKRKLLGLPIDL-DFIPVVDVYRFEPDQLPdKsfspS--TgdpGAKvEWYFFAPRVRKYPTGLRMERATLKGFWKSTGKDRPV 116
               79****************************.99**************95456551..13343336************************************ PP

       NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
               ++ +g +vg+kktLvf+ g+ap+g++t+Wvmheyrl
  EMT05947 117 IH-NGIVVGMKKTLVFHIGKAPRGTRTNWVMHEYRL 151
               **.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.06E-5712169IPR003441NAC domain
PROSITE profilePS5100553.19319169IPR003441NAC domain
PfamPF023654.4E-2520151IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MACVTVPAAT AEMERAFALP PGYRFHPTDH ELVNWFLKRK LLGLPIDLDF IPVVDVYRFE  60
PDQLPDKSFS PSTGDPGAKV EWYFFAPRVR KYPTGLRMER ATLKGFWKST GKDRPVIHNG  120
IVVGMKKTLV FHIGKAPRGT RTNWVMHEYR LHPDHRIHDT YVLCRIFNKN TMTQSPDLLS  180
GVDMDEEGMH LVANNADMDN EGFQPMSGGA NASKEAIHPV FHNANTDKEG INPVSGNIVG  240
DMEGIYPMPG DIFADMAGVH PMFGGAVPHN EETDPMSDSV VRDMEGIHPV SDSFIPDMEG  300
IHPVFGGAVP HNEETDPMSA GVYTDVDFSW MQLVPDDICC PNIELDKDDS CTELINDYMW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-451717515171NO APICAL MERISTEM PROTEIN
1ut4_B1e-451717515171NO APICAL MERISTEM PROTEIN
1ut7_A1e-451717515171NO APICAL MERISTEM PROTEIN
1ut7_B1e-451717515171NO APICAL MERISTEM PROTEIN
3swm_A1e-451717518174NAC domain-containing protein 19
3swm_B1e-451717518174NAC domain-containing protein 19
3swm_C1e-451717518174NAC domain-containing protein 19
3swm_D1e-451717518174NAC domain-containing protein 19
3swp_A1e-451717518174NAC domain-containing protein 19
3swp_B1e-451717518174NAC domain-containing protein 19
3swp_C1e-451717518174NAC domain-containing protein 19
3swp_D1e-451717518174NAC domain-containing protein 19
4dul_A1e-451717515171NAC domain-containing protein 19
4dul_B1e-451717515171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020175154.10.0NAC transcription factor 29-like
TrEMBLA0A453DME30.0A0A453DME3_AEGTS; Uncharacterized protein
STRINGEMT059470.0(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43632158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.15e-60NAC domain containing protein 57