PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05452
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family bZIP
Protein Properties Length: 90aa    MW: 10868.2 Da    PI: 9.1109
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05452genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1461.1e-14860355
              XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
    bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
              + +r++r++kNRe+A rsR+RK+a+i+eLe  v +Le+e  +L  e ee +++
  EMT05452  8 ATQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAELLREQEEQNEK 60
              679*************************************9988776655544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003386.3E-10571IPR004827Basic-leucine zipper domain
PfamPF001704.9E-13867IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.944872IPR004827Basic-leucine zipper domain
SuperFamilySSF579595.69E-121159No hitNo description
Gene3DG3DSA:1.20.5.1701.7E-141168No hitNo description
PROSITE patternPS0003601328IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 90 aa     Download sequence    Send to blast
MDPMDRAATQ RQKRMIKNRE SAARSRERKQ AYIAELEAQV TQLEEEHAEL LREQEEQNEK  60
RLNELKEQAF QVVVRKKPSQ DLRRTNSMEW
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00648PBMTransfer from LOC_Os05g36160Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT2243731e-149KT224373.1 Triticum aestivum cultivar RAC875 bZIP2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568373.14e-58PREDICTED: G-box-binding factor 4
SwissprotP427775e-23GBF4_ARATH; G-box-binding factor 4
TrEMBLA0A0Y0I9A52e-58A0A0Y0I9A5_WHEAT; BZIP2
STRINGBRADI2G24120.39e-58(Brachypodium distachyon)
STRINGMLOC_53321.18e-58(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP26653786
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44080.13e-17bZIP family protein