PlantTFDB
Plant Transcription Factor Database
v5.0
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT05172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family ZF-HD
Protein Properties Length: 114aa    MW: 12268.2 Da    PI: 5.5738
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT05172genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer77.22.1e-2449971160
  ZF-HD_dimer 11 kNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60
                 + hAas+Gg+avDGC+Ef+++ geegt  alkC+ACgCHR+FH r +++e
     EMT05172 49 RTHAASTGGYAVDGCREFIAE-GEEGTFGALKCSACGCHRSFHHRVQVYE 97
                 78******************8.999********************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5152319.3884493IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257746.0E-1545104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.9E-224994IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.1E-175092IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
MAQELPTTAN QASWEHSRRR ERPPRDEEAG GPEEVRADRA VRGGGPAPRT HAASTGGYAV  60
DGCREFIAEG EEGTFGALKC SACGCHRSFH HRVQVYEVAW DCESDTSSSS SSSS
Functional Description ? help Back to Top
Source Description
UniProtInhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3757152e-88AK375715.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv3102E24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_020146636.19e-36mini zinc finger protein 3-like
SwissprotQ0J5F84e-20MIF4_ORYSJ; Mini zinc finger protein 4
TrEMBLM8BQD19e-77M8BQD1_AEGTA; Uncharacterized protein
STRINGEMT051722e-77(Aegilops tauschii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143134120
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28917.13e-21mini zinc finger 2
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]